We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump fell asleep during New York Knicks game – real fans are furious donald trumpnew york knicksnew yorknew york citynba finalsbasketballdonald trump45m
GTA 6 LIVE: Physical game box 'spotted' on store shelves gta 6gamesgrand theft autorockstar gamesvideo gamesgta 61h
Nintendo Direct June 2026 LIVE: All the announcements as they happen nintendoconsolesgamesnintendo switchnintendo switch 2switchswitch 2video gamesnintendo34m
Trump branded ‘snowflake’ over Meet the Press interview crashout Donald Trumpnewsnbc newstrumpinterview2020 electioncaliforniadonald trumpDonald Trump23h
Olivia Rodrigo addresses babydoll dress criticism olivia rodrigodressfashioncriticismbacklasholivia rodrigoMay 29, 2026
Lewis Hamilton's wealth gap comments prove rich have no self-awareness formula 1lewis hamiltonformula onesportkim kardashianformula 120h
Trump had a bizarre excuse for his Meet the Press crashout Donald Trumpwisconsinnewstrumpnbc newsinterviewdonald trumpDonald Trump20h