Federated Contrastive Graph Attention Neural Network With Correlation Embedding for Noisy Multi-Label Classification.

Lei Gao Lei Gao 0001 Toronto Metropolitan University, Electrical and Computer Engineering, Toronto, ON, Canada Zhengzhou University, School of Information Engineering, China https://orcid.org/0000-0001-5583-713X https://www.wikidata.org/entity/Q130978874 Lei Gao 0002 皋磊 CSIRO Land and Water, Adelaide, SA, Australia University of Western Australia, School of Agricultural and Resource Economics, Crawley, Australia http://people.csiro.au/G/L/Lei-Gao http://csiro.academia.edu/LeiGao https://scholar.google.com/citations?user=AA_TNkih9JoC https://www.researcherid.com/rid/F-9698-2010 https://publons.com/researcher/915095 Lei Gao 0003 Donghua University, College of Information Sciences and Technology, Shanghai, China Lei Gao 0004 Chinese Academy of Sciences, Shenyang Institute of Automation, Key laboratory of Industrial Information Technology, China University of the Chinese Academy of Sciences, Beijing, China http://iauthor.las.ac.cn/CN/0000-0003-3527-2666 https://orcid.org/0000-0003-3527-2666 https://www.researcherid.com/rid/C-4181-2015 Lei Gao 0005 Shandong Normal University, School of Mathematical Sciences, Jinan, China https://orcid.org/0000-0003-0979-9456 Lei Gao 0006 Harbin Institute of Technology, School of Electrical Engineering and Automation, Harbin, China https://orcid.org/0000-0002-6098-4289 https://orcid.org/0000-0001-5192-392X Lei Gao 0007 https://orcid.org/0000-0001-5301-0876 https://www.wikidata.org/entity/Q131129453 University College, London, UK Lei Gao 0008 https://orcid.org/0000-0001-9168-816X Southwest Petroleum University, Chengdu, China Lei Gao 0009 https://scholar.google.com/citations?user=dbMhQT4AAAAJ https://orcid.org/0000-0001-5958-4061 University of Electronic Science, Technology of China, Chengdu, China Lei Gao 0010 https://orcid.org/0000-0002-8775-9209 China Electric Power Research Institute, Beijing, China Lei Gao 0011 https://orcid.org/0000-0002-4707-0933 University of Georgia, Athens, GA, USA

Lei Zhong Xue-Jiao Jiang Kaihong Zheng Jia-Long Xu Zheng Fu Lei Gao Sheng Li Federated Contrastive Graph Attention Neural Network With Correlation Embedding for Noisy Multi-Label Classification. 2026 18332-18342 14 IEEE Access https://doi.org/10.1109/ACCESS.2026.3654141 db/journals/access/access14.html#ZhongJZXFGL26 streams/journals/access

Lanqin Zheng Zhe Shi Lei Gao A generative artificial intelligence-enhanced multiagent approach to empowering collaborative problem solving across different learning domains. 105489 2026 241 Comput. Educ. https://doi.org/10.1016/j.compedu.2025.105489 db/journals/ce/ce241.html#ZhengSG26 streams/journals/ce

Lei Gao Morris Siu-Yung Jong Ching Sing Chai Keru Li STEM education: Understanding secondary students' epistemic cognition in the design process with the support of a personalized multi-agent system. 105504 2026 242 Comput. Educ. https://doi.org/10.1016/j.compedu.2025.105504 db/journals/ce/ce242.html#GaoJCL26 streams/journals/ce

Yi Liu 0128 Samuel Ortega-Farías Weicai Yang Yunfei Fan Sufen Wang Lei Gao Daniel de la Fuente-Sáiz Peng Zhao Fei Tian Improvement of the METRIC model for mapping actual evapotranspiration of irrigated vineyards: Case study of Chilean and Chinese regions. 2026 111563 245 Comput. Electron. Agric. https://doi.org/10.1016/j.compag.2026.111563 db/journals/cea/cea245.html#LiuOYFWGFZT26 streams/journals/cea

Lei Gao Taichang Tian Luosheng Wen Time-series clustering algorithm based on common tightest neighbors and local embedding. 2026 105895 173 Digit. Signal Process. https://doi.org/10.1016/j.dsp.2026.105895 db/journals/dsp/dsp173.html#GaoTW26 streams/journals/dsp

Bao Liu Jiaxin Li Xianfu Jiang Matthew Gibbs Zirun Zhu Xueqing Wang Klaus Joehnk Lei Gao Enhancing riverine cyanobacterial bloom prediction: A hybrid deep learning approach combining wavelet decomposition, double-layer LSTM, ARIMA, and residual compensation. 106764 2026 196 Environ. Model. Softw. https://doi.org/10.1016/j.envsoft.2025.106764 db/journals/envsoft/envsoft196.html#LiuLJGZWJG26 streams/journals/envsoft

Bing Wei Yingying Zhang Haoyu Zhang Ruyu Liu Lei Gao Lusi Li SEMDI-Net: Deep learning techniques for denoising scanning electron microscope images of fiber masterbatches. 132378 2026 669 Neurocomputing https://doi.org/10.1016/j.neucom.2025.132378 db/journals/ijon/ijon669.html#WeiZZLGL26

Lei Chen Ai Liu Peng Cai Hang Ming Yu Long 0004 Yujia Li Yulong Cao Ligang Huang Daqiu Zhou Lei Gao Ultrafast Single Pulse Imaging With Large Field of View for Dynamic Measurement Based on Virtually Imaged Phased Array. 2026 January 36 Int. J. Imaging Syst. Technol. 1 https://doi.org/10.1002/ima.70284 db/journals/imst/imst36.html#ChenLCMLLCHZG26 streams/journals/imst

Lei Gao Shu Yan Kaiyuan Feng Haonan Liu Zihao Zhang Xingxing Diao Benchmarking In Silico Metabolite Prediction Tools against Human Radiolabeled ADME Data for Small-Molecule Drugs. 2026 2918-2928 66 J. Chem. Inf. Model. 5 https://doi.org/10.1021/acs.jcim.5c03045 db/journals/jcisd/jcisd66.html#GaoYFLZD26 streams/journals/jcisd

Xiaole Li Yinghui Jiang Xing Wang Jiuru Wang Lei Gao Shanwen Yi Data evacuation optimization using multi-objective reinforcement learning. 104390 2026 245 J. Netw. Comput. Appl. https://doi.org/10.1016/j.jnca.2025.104390 db/journals/jnca/jnca245.html#LiJWWGY26 streams/journals/jnca

Bao Liu Wenyao Ren Haoran Li Yuqing Liang Jiaxin Li Lei Gao A multi-strategy improved marine predator algorithm for large-scale optimization. 1277-1283 2026 CNML https://doi.org/10.1109/CNML68938.2026.11453131 conf/cnml/2026 db/conf/cnml/cnml2026.html#LiuRLLLG26

Longxiang Wei Hao Lei Xiaokang Qi Xiaohan Sun Lei Gao Kai Hu 0001 Wei Wang 0035 Meiqin Wang Cryptanalytic Extraction of Recurrent Neural Network Models. 2026 168 2026 IACR Cryptol. ePrint Arch. https://eprint.iacr.org/2026/168 db/journals/iacr/iacr2026.html#WeiLQSGHWW26 streams/journals/iacr

Zhuolong Zhang Muzhou Li Lei Gao Meiqin Wang Collision Attacks on SHA-256 up to 37 Steps with Improved Trail Search. 2026 232 2026 IACR Cryptol. ePrint Arch. https://eprint.iacr.org/2026/232 db/journals/iacr/iacr2026.html#ZhangLGW26 streams/journals/iacr

Zhixin Liu 0001 Lei Gao Ziyang Ma Jiawei Su Fenglei Li Yazhou Yuan Xinping Guan Joint task offloading and resource allocation scheme with UAV assistance in vehicle edge computing networks. 111746 2025 273 Comput. Networks https://doi.org/10.1016/j.comnet.2025.111746 db/journals/cn/cn273.html#LiuGMSLYG25 streams/journals/cn

Lei Gao Dan Zhang Yaoran Chen Xiaowei Li Chunxin Li Yan Peng Global-local adaptive resampling strategy for enhancing the performance of Physics-informed neural networks. 111283 2025 158 Eng. Appl. Artif. Intell. https://doi.org/10.1016/j.engappai.2025.111283 db/journals/eaai/eaai158.html#GaoZCLLP25 streams/journals/eaai

Guowei Ji Baoping Cai Xuelin Liu Yi Jiang Yixin Zhao Qingping Li Lei Gao Kaizheng Wu Leakage localization methodology based on dynamic pressure signal for subsea pipeline. 112212 2025 161 Eng. Appl. Artif. Intell. https://doi.org/10.1016/j.engappai.2025.112212 db/journals/eaai/eaai161.html#JiCLJZLGW25 streams/journals/eaai

Bao Liu Siqi Chen Lei Gao Combining residual convolutional LSTM with attention mechanisms for spatiotemporal forest cover prediction. 106260 2025 183 Environ. Model. Softw. https://doi.org/10.1016/j.envsoft.2024.106260 db/journals/envsoft/envsoft183.html#LiuCG25 streams/journals/envsoft

Lei Gao Taichang Tian Luosheng Wen Study on outlier detection algorithm based on tightest neighbors. 128385 2025 290 Expert Syst. Appl. https://doi.org/10.1016/j.eswa.2025.128385 db/journals/eswa/eswa290.html#GaoTW25 streams/journals/eswa

Lei Gao Zhihao Liu Qinhe Gao Hongjie Cheng Jianyong Yao Xiaoli Zhao 0002 Sixiang Jia Graph isomorphism wavelet convolutional networks for small-sample fault diagnosis of rotating machinery using multi-sensor information fusion. 128615 2025 292 Expert Syst. Appl. https://doi.org/10.1016/j.eswa.2025.128615 db/journals/eswa/eswa292.html#GaoLGCYZJ25 streams/journals/eswa

Lei Gao Jingfeng Lu Zhewei Wang Move orders in contests: Equilibria and winning chances. 436-468 2025 150 Games Econ. Behav. https://doi.org/10.1016/j.geb.2025.02.003 db/journals/geb/geb150.html#GaoLW25 streams/journals/geb

Lanqin Zheng Lei Gao Zichen Huang Zhe Shi Yujun Zhou 0011 A systematic meta-analysis of the impacts of group awareness tools on learning achievements, learning behaviors, and learning perceptions from 2010-2023. 3871-3888 2025 July 33 Interact. Learn. Environ. 6 https://doi.org/10.1080/10494820.2025.2454440 db/journals/ile/ile33.html#ZhengGHSZ25 streams/journals/ile

Dazhuang Li Lei Gao Xiaolong Lai Zhengkang Ou Jingzhen Yan Chaolong Wu Application of Huangling mianhua image recognition and classification system based on deep learning. 346 2025 December 28 Discov. Comput. 1 https://doi.org/10.1007/s10791-025-09873-y db/journals/ir/ir28.html#LiGLOYW25 streams/journals/ir

Lanqin Zheng Zichen Huang Lei Gao Yunchao Fan An Artificial Intelligence-Enabled Group Cognitive Diagnosis Approach With the Goal of Promoting Online Collaborative Learning. 2025 41 J. Comput. Assist. Learn. 5 https://doi.org/10.1111/jcal.70113 db/journals/jcal/jcal41.html#ZhengHGF25 streams/journals/jcal

Yi Jiang Baoping Cai Xuelin Liu Guowei Ji Yixin Zhao Qingping Li Lei Gao Kaizheng Wu Leakage localization methodology based on time difference of arrival of sound wave for subsea manifold. 100982 2025 48 J. Ind. Inf. Integr. https://doi.org/10.1016/j.jii.2025.100982 db/journals/jiii/jiii48.html#JiangCLJZLGW25 streams/journals/jiii

Jian Liu Junkang Guo Lei Gao Yuhang Wang Aolei Liu Xin Zhang PPTformer: A novel hybrid model for enhanced long-term time series forecasting with extreme value focus. 113456 2025 317 Knowl. Based Syst. https://doi.org/10.1016/j.knosys.2025.113456 db/journals/kbs/kbs317.html#LiuGGWLZ25 streams/journals/kbs

Bao Liu Xianfu Jiang Fengran Wang Yuxin Wang Lei Gao Enhanced bearing fault diagnosis under strong noise: A deep residual network with combined attention mechanisms. 114678 2025 330 Knowl. Based Syst. https://doi.org/10.1016/j.knosys.2025.114678 db/journals/kbs/kbs330.html#LiuJWWG25 streams/journals/kbs

Bao Liu Yuqing Liang Zirun Zhu Lei Gao Bio-inspired model for oil production prediction: combining gene regulation-based optimization and radial basis function network. 24 2025 June 17 Memetic Comput. 2 https://doi.org/10.1007/s12293-025-00455-5 db/journals/memetic/memetic17.html#LiuLZG25 streams/journals/memetic

Yanping Zhang 0004 Baoping Cai Salim Ahmed Chengyushu Wang Qingping Li Lei Gao A resilience-driven emergency maintenance operation scheme optimization method based on risk. 110630 2025 254 Reliab. Eng. Syst. Saf. https://doi.org/10.1016/j.ress.2024.110630 db/journals/ress/ress254.html#ZhangCAWLG25 streams/journals/ress

Lei Gao Qinhe Gao Zhihao Liu Hongjie Cheng Jianyong Yao Xiaoli Zhao 0002 Sixiang Jia Multiple classifiers inconsistency-based deep adversarial domain generalization method for cross-condition fault diagnosis in rotating systems. 111017 2025 260 Reliab. Eng. Syst. Saf. https://doi.org/10.1016/j.ress.2025.111017 db/journals/ress/ress260.html#GaoGLCYZJ25 streams/journals/ress

Jian Liu Jianghua Mao Yuqi Wang Hao He Ye Jiang Feibiao Dong Minghui Shen Ruiyan Sun Lei Gao An Efficient and Explainable Ensemble-learning Framework for Early Lung Cancer Biomarkers Detection. 2736-2749 2025 22 IEEE Trans. Comput. Biol. Bioinform. 6 https://doi.org/10.1109/tcbbio.2025.3605045 db/journals/tcbb/tcbb22.html#LiuMWHJDSSG25 streams/journals/tcbb

Yi Yang Qi Zhou Li Zhang 0073 Dajun Du Min Zheng Qun Niu Lei Gao Xiaodong Yuan Recent progresses in state estimation of lithium-ion battery energy storage systems: A review. 3064-3077 2025 47 Trans. Inst. Meas. Control 15 https://doi.org/10.1177/01423312221124354 db/journals/tinstmc/tinstmc47.html#YangZZDZNGY25 streams/journals/tinstmc

Yi Yang Qi Zhou Min Zheng Qun Niu Li Zhang 0073 Dajun Du Lei Gao Xiaodong Yuan Extreme learning machine-radial basis function neural network-based state-of-charge estimation of lithium-ion batteries assisted with fiber Bragg grating sensor measurements. 3088-3097 2025 47 Trans. Inst. Meas. Control 15 https://doi.org/10.1177/01423312221144475 db/journals/tinstmc/tinstmc47.html#YangZZNZDGY25 streams/journals/tinstmc

Lei Gao Jingfei Jiang Jinwei Xu Weijia Wang Pengbo Wu SAPFIS: a parallel fuzzy inference system for air combat situation assessment. 73 2025 January 81 J. Supercomput. 1 https://doi.org/10.1007/s11227-024-06521-y db/journals/tjs/tjs81.html#GaoJXWW25 streams/journals/tjs

Jinwei Xu Jingfei Jiang Lei Gao Xifu Qian Yong Dou SPDFA: A Novel Dataflow Fusion Sparse Deep Neural Network Accelerator. 38:1-38:23 2025 September 18 ACM Trans. Reconfigurable Technol. Syst. 3 https://doi.org/10.1145/3737462 db/journals/trets/trets18.html#XuJGQD25 streams/journals/trets

Lei Gao Zhixin Liu 0001 Jiawei Su Kit Yan Chan Yazhou Yuan Outage probability constrained resource allocation scheme in two-tier cooperative NOMA network with SWIPT. 315-325 2025 January 31 Wirel. Networks 1 https://doi.org/10.1007/s11276-024-03763-9 db/journals/winet/winet31.html#GaoLSCY25 streams/journals/winet

Yafei Li Wei Chen 0001 Jinxing Yan Huiling Li Lei Gao Mingliang Xu 0001 Gradient-Guided Credit Assignment and Joint Optimization for Dependency-Aware Spatial Crowdsourcing. 14301-14308 2025 AAAI https://doi.org/10.1609/aaai.v39i13.33566 conf/aaai/2025 db/conf/aaai/aaai2025.html#LiCYLGX25 Chaoyi Jiang Lei Gao Hossein Entezari Zarch Murali Annavaram KVPR: Efficient LLM Inference with I/O-Aware KV Cache Partial Recomputation. 19474-19488 2025 ACL (Findings) https://aclanthology.org/2025.findings-acl.997/ conf/acl/2025f db/conf/acl/acl2025f.html#JiangGZA25 Lei Gao Amir Ziashahabi Yue Niu Salman Avestimehr Murali Annavaram MobiZO: Enabling Efficient LLM Fine-Tuning at the Edge via Inference Engines. 20206-20223 2025 EMNLP https://doi.org/10.18653/v1/2025.emnlp-main.1022 conf/emnlp/2025 db/conf/emnlp/emnlp2025.html#GaoZNAA25 streams/conf/emnlp Zhiming Shao Yingqian Zhang 0003 Zechen Wei Yong Ge Chen Wang Guodong Ding Lei Gao Liwei Zhang Yundai Chen Jie Tian 0001 Hui Hui Contrastive Masked Video Modeling for Coronary Angiography Diagnosis. 128-138 2025 MICCAI (9) https://doi.org/10.1007/978-3-032-05114-1_13 conf/miccai/2025-9 db/conf/miccai/miccai2025-9.html#ShaoZWGWDGZCTH25 streams/conf/miccai Jialei Cui Jianwei Du Yanzhe Li Lei Gao Hui Jiang Chenfu Bao HAMLET-FFD: Hierarchical Adaptive Multi-modal Learning Embeddings Transformation for Face Forgery Detection. 1327-1336 2025 ACM Multimedia https://doi.org/10.1145/3746027.3755137 conf/mm/2025 db/conf/mm/mm2025.html#CuiDLGJB25

Hossein Entezari Zarch Lei Gao Chaoyi Jiang Murali Annavaram DEL: Context-Aware Dynamic Exit Layer for Efficient Self-Speculative Decoding. 2025 April abs/2504.05598 CoRR https://doi.org/10.48550/arXiv.2504.05598 db/journals/corr/corr2504.html#abs-2504-05598 streams/journals/corr

Chaoyi Jiang Sungwoo Kim 0003 Lei Gao Hossein Entezari Zarch Won Woo Ro Murali Annavaram MARché: Fast Masked Autoregressive Image Generation with Cache-Aware Attention. 2025 June abs/2506.12035 CoRR https://doi.org/10.48550/arXiv.2506.12035 db/journals/corr/corr2506.html#abs-2506-12035 streams/journals/corr

Jialei Cui Jianwei Du Yanzhe Li Lei Gao Hui Jiang Chenfu Bao HAMLET-FFD: Hierarchical Adaptive Multi-modal Learning Embeddings Transformation for Face Forgery Detection. 2025 July abs/2507.20913 CoRR https://doi.org/10.48550/arXiv.2507.20913 db/journals/corr/corr2507.html#abs-2507-20913 streams/journals/corr

Ben Zhang LuLu Yu Lei Gao Jing Liu QuanJiang Guo Hui Gao ViFP: A Framework for Visual False Positive Detection to Enhance Reasoning Reliability in VLMs. 2025 August abs/2508.04201 CoRR https://doi.org/10.48550/arXiv.2508.04201 db/journals/corr/corr2508.html#abs-2508-04201 streams/journals/corr

Hossein Entezari Zarch Lei Gao Chaoyi Jiang Murali Annavarm DELTA: Dynamic Layer-Aware Token Attention for Efficient Long-Context Reasoning. 2025 October abs/2510.09883 CoRR https://doi.org/10.48550/arXiv.2510.09883 db/journals/corr/corr2510.html#abs-2510-09883 streams/journals/corr

Lei Gao Shihong Huang Shengjie Wang Hong Ma Feng Zhang HengDa Bao Qichang Chen Weihua Zhou One4Many-StablePacker: An Efficient Deep Reinforcement Learning Framework for the 3D Bin Packing Problem. 2025 October abs/2510.10057 CoRR https://doi.org/10.48550/arXiv.2510.10057 db/journals/corr/corr2510.html#abs-2510-10057 streams/journals/corr

Asmita Mohanty Gezheng Kang Lei Gao Murali Annavaram DistilLock: Safeguarding LLMs from Unauthorized Knowledge Distillation on the Edge. 2025 October abs/2510.16716 CoRR https://doi.org/10.48550/arXiv.2510.16716 db/journals/corr/corr2510.html#abs-2510-16716 streams/journals/corr

Lei Gao Chaoyi Jiang Hossein Entezari Zarch Daniel Wong 0001 Murali Annavaram DuetServe: Harmonizing Prefill and Decode for LLM Serving via Adaptive GPU Multiplexing. 2025 November abs/2511.04791 CoRR https://doi.org/10.48550/arXiv.2511.04791 db/journals/corr/corr2511.html#abs-2511-04791 streams/journals/corr

Arun Ramachandran Ramaswamy Govindarajan Murali Annavaram Prakash Raghavendra Hossein Entezari Zarch Lei Gao Chaoyi Jiang Striking the Right Balance between Compute and Copy: Improving LLM Inferencing Under Speculative Decoding. 2025 November abs/2511.12031 CoRR https://doi.org/10.48550/arXiv.2511.12031 db/journals/corr/corr2511.html#abs-2511-12031 streams/journals/corr

Keqiang Li 0001 Guifa Teng Jiantao Wang Yuxin Zhang Lei Gao Hui Feng Body Condition Scoring of Dairy Cows Based on Feature Point Location. 5270-5283 2024 12 IEEE Access https://doi.org/10.1109/ACCESS.2023.3349320 db/journals/access/access12.html#LiTWZGF24

Fei Luo Qiangsheng Bu Zhigang Ye Yubo Yuan 0003 Lei Gao Pengpeng Lv Dynamic Reconstruction Strategy of Distribution Network Based on Uncertainty Modeling and Impact Analysis of Wind and Photovoltaic Power. 64069-64078 2024 12 IEEE Access https://doi.org/10.1109/ACCESS.2024.3394856 db/journals/access/access12.html#LuoBYYGL24

Dantian Zhong Lei Gao Zhiyuan Cai Design of Defect Identification and Location System for UHV AC Surge Arrester. 157487-157495 2024 12 IEEE Access https://doi.org/10.1109/ACCESS.2024.3482981 db/journals/access/access12.html#ZhongGC24 streams/journals/access

Lin Yang Haiwei Zhang Jiexin Sheng Meng Wang Yaliang Liu Min Xu Xiao Yang Bo Wang Xiaolong He Lei Gao Chao Zheng Contrast enhancement boost improves the image quality of CT angiography derived from 80-kVp cerebral CT perfusion data. 193 2024 December 24 BMC Medical Imaging 1 https://doi.org/10.1186/s12880-024-01373-7 db/journals/bmcmi/bmcmi24.html#YangZSWLXYWHGZ24 streams/journals/bmcmi

Yong Zhang Xin Wei Lei Gao Weijie Zhao 0013 Changjiu Sun Junli Wei Mingjian Yuan Zhenhua Ni Junpeng Lu Hongwei Liu Stable α-CsPbI3 with extremely red emission for expanding the color gamut. 2024 67 Sci. China Inf. Sci. 5 https://doi.org/10.1007/s11432-023-3944-3 db/journals/chinaf/chinaf67.html#ZhangWGZSWYNLL24

Lanqin Zheng Yunchao Fan Bodong Chen Zichen Huang Lei Gao Miaolang Long An AI-enabled feedback-feedforward approach to promoting online collaborative learning. 11385-11406 2024 June 29 Educ. Inf. Technol. 9 https://doi.org/10.1007/s10639-023-12292-5 db/journals/eait/eait29.html#ZhengFCHLL24 streams/journals/eait

Quanliang Ye Qi Liu 0045 Deepthi Swamy Lei Gao Enayat A. Moallemi Felicjan Rydzak Sibel Eker FeliX 2.0: An integrated model of climate, economy, environment, and society interactions. 106121 2024 179 Environ. Model. Softw. https://doi.org/10.1016/j.envsoft.2024.106121 db/journals/envsoft/envsoft179.html#YeLSGMRE24 streams/journals/envsoft

Qianyuan Zou Huidong Bai Lei Gao Gun A. Lee Allan Fowler Mark Billinghurst Stylus and Gesture Asymmetric Interaction for Fast and Precise Sketching in Virtual Reality. 8124-8141 2024 December 40 Int. J. Hum. Comput. Interact. 23 https://doi.org/10.1080/10447318.2023.2278294 db/journals/ijhci/ijhci40.html#ZouBGLFB24 streams/journals/ijhci

Lanqin Zheng Yunchao Fan Lei Gao Zichen Huang The impact of learning analytics interventions on learning achievements: a meta-analysis of research from 2012 to 2021. 6267-6282 2024 November 32 Interact. Learn. Environ. 10 https://doi.org/10.1080/10494820.2023.2255231 db/journals/ile/ile32.html#ZhengFGH24 streams/journals/ile

Lei Gao Heng Wang Monitoring and Prediction of Settlement and Deformation of Ancient Building Foundations Based on Neural Networks. 2024 48 Informatica (Slovenia) 13 https://doi.org/10.31449/inf.v48i13.6011 db/journals/informaticaSI/informaticaSI48.html#GaoW24 streams/journals/informaticaSI

Lanqin Zheng Yunchao Fan Zichen Huang Lei Gao Impacts of three approaches on collaborative knowledge building, group performance, behavioural engagement, and socially shared regulation in online collaborative learning. 21-36 2024 February 40 J. Comput. Assist. Learn. 1 https://doi.org/10.1111/jcal.12860 db/journals/jcal/jcal40.html#ZhengFHG24

Jun Yang Baoping Cai Xiangdi Kong Xiaoyan Shao Bo Wang Yulong Yu Lei Gao Chao Yang 0038 Yonghong Liu A digital twin-assisted intelligent fault diagnosis method for hydraulic systems. 100725 2024 42 J. Ind. Inf. Integr. https://doi.org/10.1016/j.jii.2024.100725 db/journals/jiii/jiii42.html#YangCKSWYGyL24 streams/journals/jiii

Siqi Feng Lei Gao Guangchen Wang Hua Xiao 0002 Maximum Principle for Stochastic Control System with Elephant Memory and Jump Diffusion. 1392-1412 2024 August 37 J. Syst. Sci. Complex. 4 https://doi.org/10.1007/s11424-024-3163-7 db/journals/jossac/jossac37.html#FengGWX24

Lei Gao Xian-Ming Gu Xiudan Jia Chaoqian Li Upper triangulation-based infinity norm bounds for the inverse of Nekrasov matrices with applications. 1453-1479 2024 December 97 Numer. Algorithms 4 https://doi.org/10.1007/s11075-024-01758-3 db/journals/na/na97.html#GaoGJL24 streams/journals/na

Xiangdong Ran Zhiguang Shan Yukang Fan Lei Gao A model based LSTM and graph convolutional network for stock trend prediction. e2326 2024 10 PeerJ Comput. Sci. https://doi.org/10.7717/peerj-cs.2326 db/journals/peerj-cs/peerj-cs10.html#RanSFG24 streams/journals/peerj-cs

Fei Guo Zhen Xu 0001 Honghong Ma Xiujin Liu Lei Gao On Optimizing Hyperspectral Inversion of Soil Copper Content by Kernel Principal Component Analysis. 2914 2024 August 16 Remote. Sens. 16 https://doi.org/10.3390/rs16162914 db/journals/remotesensing/remotesensing16.html#GuoXMLG24 streams/journals/remotesensing

Yanping Zhang 0004 Baoping Cai Yixin Zhao Chuntan Gao Yiliu Liu Lei Gao Guijie Liu Joint multi-objective optimization method for emergency maintenance and condition-based maintenance: Subsea control system as a case study. 110307 2024 250 Reliab. Eng. Syst. Saf. https://doi.org/10.1016/j.ress.2024.110307 db/journals/ress/ress250.html#ZhangCZGLGL24

Xiaoyan Shao Baoping Cai Lei Gao Yanping Zhang 0004 Chao Yang 0038 Chuntan Gao Data-model-linked remaining useful life prediction method with small sample data: A case of subsea valve. 110323 2024 250 Reliab. Eng. Syst. Saf. https://doi.org/10.1016/j.ress.2024.110323 db/journals/ress/ress250.html#ShaoCGZYG24 streams/journals/ress

Yuyi Wu Lei Gao Jing Chai Zhi Li Chenyang Ma Fengqi Qiu Qiang Yuan Dingding Zhang Overview of Health-Monitoring Technology for Long-Distance Transportation Pipeline and Progress in DAS Technology Application. 413 2024 January 24 Sensors 2 https://doi.org/10.3390/s24020413 db/journals/sensors/sensors24.html#WuGCLMQYZ24

Lei Gao Minzhe Li Zhongliang Jing Multiple maneuvering target tracking based on hierarchical Dirichlet process and hidden Markov model. 109344 2024 April 217 Signal Process. https://doi.org/10.1016/j.sigpro.2023.109344 db/journals/sigpro/sigpro217.html#GaoLJ24

Fei Yu 0009 Lei Gao Shuo Cai Sichun Du Analysis and Design of a Low-Voltage Low-Power High SNDR Current-Mode Sample and Hold Circuit Based on CMOS Technology. 615-629 2024 July 137 Wirel. Pers. Commun. 1 https://doi.org/10.1007/s11277-024-11444-1 db/journals/wpc/wpc137.html#YuGCD24 streams/journals/wpc

Lei Gao Xiaohong Yan Hu Zhu Infrared Spectral Deconvolution Algorithm Based on Masked Pre-training Transformer. 70:1-70:6 2024 CVDL https://doi.org/10.1145/3653804.3656268 https://www.wikidata.org/entity/Q130924408 conf/cvdl/2024 db/conf/cvdl/cvdl2024.html#GaoYZ24 Lei Gao Yue Niu Tingting Tang Salman Avestimehr Murali Annavaram Ethos: Rectifying Language Models in Orthogonal Parameter Space. 2054-2068 2024 NAACL-HLT (Findings) https://doi.org/10.18653/v1/2024.findings-naacl.132 conf/naacl/2024f db/conf/naacl/naacl2024f.html#GaoNTAA24 streams/conf/naacl Biao Lyu Enge Song Tian Pan 0001 Jianyuan Lu Shize Zhang Xiaoqing Sun Lei Gao Chenxiao Wang Han Xiao Yong Pan Xiuheng Chen Yandong Duan Weisheng Wang Jinpeng Long Yanfeng Wang Kunpeng Zhou Zhigang Zong Xing Li 0007 Guangwang Li Pengyu Zhang Peng Cheng 0001 Jiming Chen 0001 Shunmin Zhu POSEIDON: A Consolidated Virtual Network Controller that Manages Millions of Tenants via Config Tree. 2024 NSDI https://www.usenix.org/conference/nsdi24/presentation/lyu conf/nsdi/2024 db/conf/nsdi/nsdi2024.html#LyuS0LZSGWXPCDW24

Xinxin Zhang Lei Gao Deep Learning Based Resource Allocation for Full-duplex Device-to-Device Communication. 2024 abs/2401.04906 CoRR https://doi.org/10.48550/arXiv.2401.04906 db/journals/corr/corr2401.html#abs-2401-04906

Lei Gao Yue Niu Tingting Tang Salman Avestimehr Murali Annavaram Ethos: Rectifying Language Models in Orthogonal Parameter Space. 2024 abs/2403.08994 CoRR https://doi.org/10.48550/arXiv.2403.08994 db/journals/corr/corr2403.html#abs-2403-08994

Yonghui Nie Zhi Li Jie Zhang Lei Gao Yang Li Hengyu Zhou Optimal Dispatch Strategy for a Multi-microgrid Cooperative Alliance Using a Two-Stage Pricing Mechanism. 2024 abs/2408.13289 CoRR https://doi.org/10.48550/arXiv.2408.13289 db/journals/corr/corr2408.html#abs-2408-13289 streams/journals/corr

Lei Gao Amir Ziashahabi Yue Niu Salman Avestimehr Murali Annavaram Enabling Resource-Efficient On-Device Fine-Tuning of LLMs Using Only Inference Engines. 2024 abs/2409.15520 CoRR https://doi.org/10.48550/arXiv.2409.15520 db/journals/corr/corr2409.html#abs-2409-15520 streams/journals/corr

Chaoyi Jiang Lei Gao Hossein Entezari Zarch Murali Annavaram Efficient LLM Inference with I/O-Aware Partial KV Cache Recomputation. 2024 abs/2411.17089 CoRR https://doi.org/10.48550/arXiv.2411.17089 db/journals/corr/corr2411.html#abs-2411-17089 streams/journals/corr

Bo Song Hao Li Mengyun Jiang Zhongtian Gao Suikang Wang Lei Gao Yunsheng Chen Wujiao Li slORFfinder: a tool to detect open reading frames resulting from trans-splicing of spliced leader sequences. 2023 January 24 Briefings Bioinform. 1 https://doi.org/10.1093/bib/bbac610 db/journals/bib/bib24.html#SongLJGWGCL23

Tingting Hu Xingyuan Yang Lei Gao Ying Liu Wei Zhang Yan Wang Xiaona Zhu Xiangdong Liu Hongran Liu Xiaohui Ma Feasibility analysis of low-dose CT with asynchronous quantitative computed tomography to assess vBMD. 149 2023 December 23 BMC Medical Imaging 1 https://doi.org/10.1186/s12880-023-01115-1 db/journals/bmcmi/bmcmi23.html#HuYGLZWZLLM23

Haifeng Wan Lei Gao Zhaodi Yuan Hui Qu Qirun Sun Hao Cheng Ruibao Wang A novel transformer model for surface damage detection and cognition of concrete bridges. 119019 2023 March 213 Expert Syst. Appl. Part C https://doi.org/10.1016/j.eswa.2022.119019 db/journals/eswa/eswa213.html#WanGYQSCW23

Yichang Gao Yingping Sun Lidi Zhang Fengming Liu Lei Gao Identifying key rumor refuters on social media. 120603 2023 November 231 Expert Syst. Appl. https://doi.org/10.1016/j.eswa.2023.120603 db/journals/eswa/eswa231.html#GaoSZLG23

Lei Gao Xiaoyong Zhu ICN-Based Enhanced Content Delivery for CDN. 390 2023 15 Future Internet 12 https://doi.org/10.3390/fi15120390 db/journals/fi/fi15.html#GaoZ23

Zhanyuan Xie Xiaoyu Zhao Di Han 0001 Lei Gao Zheng Jiang 0005 Jianchi Zhu Xiaoming She Peng Chen 0028 A Markovian Queueing Model for End-to-End Delay Analysis in Computation Offloading System. 2687-2691 2023 October 27 IEEE Commun. Lett. 10 https://doi.org/10.1109/LCOMM.2023.3307876 db/journals/icl/icl27.html#XieZHGJZSC23

Bo Tan Zhuohong Pan Xuefang Tong Yan Wang Xianghan Wang Lei Gao Intelligent Inversion of Coastal Earth Resistivity. 2359008:1-2359008:26 2023 July 37 Int. J. Pattern Recognit. Artif. Intell. 9 https://doi.org/10.1142/S0218001423590085 db/journals/ijprai/ijprai37.html#TanPTWWG23

Hongguang Pan Xinyu Yu Lei Gao Yongfu Li 0001 Wei Hua 0002 Model Predictive Control-Based Multivariable Controller for Traffic Flows in Automated Freeway Systems. 149-161 2023 March - April 15 IEEE Intell. Transp. Syst. Mag. 2 https://doi.org/10.1109/MITS.2022.3182648 db/journals/itsm/itsm15.html#PanYGLH23

Feng Liu 0005 Lei Gao Jun Wan 0007 Zhi-Lei Lyu Ying-Ying Huang Chao Liu Min Han Recognition of Digital Dental X-ray Images Using a Convolutional Neural Network. 73-79 2023 February 36 J. Digit. Imaging 1 https://doi.org/10.1007/s10278-022-00694-9 db/journals/jdi/jdi36.html#LiuGWLHLH23

Thomas G. Calderon Lei Gao Innovative and Novel Research Datasets Related to Cybersecurity Risk Disclosures: A Research Note. 123-128 2023 June 37 J. Inf. Syst. 2 https://doi.org/10.2308/isys-2022-065 db/journals/jisys/jisys37.html#CalderonG23

Yaji Wang Zhi Li 0066 Lei Gao Yong Zhong Xinhua Peng Comparison of GPM IMERG Version 06 Final Run Products and Its Latest Version 07 Precipitation Products across Scales: Similarities, Differences and Improvements. 5622 2023 December 15 Remote. Sens. 23 https://doi.org/10.3390/rs15235622 db/journals/remotesensing/remotesensing15.html#WangLGZP23

Chenyushu Wang Baoping Cai Xiaoyan Shao Liqian Zhao Zhongfei Sui Keyang Liu Javed Akbar Khan Lei Gao Dynamic risk assessment methodology of operation process for deepwater oil and gas equipment. 109538 2023 November 239 Reliab. Eng. Syst. Saf. https://doi.org/10.1016/j.ress.2023.109538 db/journals/ress/ress239.html#WangCSZSLKG23

Wenjing Zhao Lei Gao Aiping Zhai Dong Wang Comparison of Common Algorithms for Single-Pixel Imaging via Compressed Sensing. 4678 2023 23 Sensors 10 https://doi.org/10.3390/s23104678 db/journals/sensors/sensors23.html#ZhaoGZW23

Tong Huang Qinhe Gao Zhihao Liu Dong Wang Dong Ma Lei Gao Characterization Method of Damage Information Based on Heterogeneous Network. 6035 2023 July 23 Sensors 13 https://doi.org/10.3390/s23136035 db/journals/sensors/sensors23.html#HuangGLWMG23

Lei Gao Chenzhi Cai Chao Li Cheuk Ming Mak Numerical Analysis of the Mitigation Performance of a Buried PT-WIB on Environmental Vibration. 7666 2023 September 23 Sensors 18 https://doi.org/10.3390/s23187666 db/journals/sensors/sensors23.html#GaoCLM23

Yu Long 0004 Qiang Wu Zhenghu Chang Ai Liu Yuanjie Yu Shiyun Dai Peng Cai Ligang Huang Lei Gao Tao Zhu Observation of Hidden Asymmetry in Polarization Space for Dissipative Soliton Fiber Lasers. 95 2023 15 Symmetry 1 https://doi.org/10.3390/sym15010095 db/journals/symmetry/symmetry15.html#LongWCLYDCHGZ23

Changliang Luo Zhao Wen Lei Gao Xiaotong Cui Side-Channel Attacks Based on Deep Learning. 33-37 2023 AAIA https://doi.org/10.1145/3603273.3630505 https://www.wikidata.org/entity/Q130890206 conf/aaia/2023 db/conf/aaia/aaia2023.html#LuoWGC23 Yuetian Zhou Fang Nan Lei Gao Operator Perspective: How to Choose between the RIS and Full/Half-Duplex Relay. 1-6 2023 BMSB https://doi.org/10.1109/BMSB58369.2023.10211119 conf/bmsb/2023 db/conf/bmsb/bmsb2023.html#ZhouNG23 Tuo Zhang Lei Gao Sunwoo Lee 0001 Mi Zhang 0002 Salman Avestimehr TimelyFL: Heterogeneity-aware Asynchronous Federated Learning with Adaptive Partial Training. 5064-5073 2023 CVPR Workshops https://doi.org/10.1109/CVPRW59228.2023.00535 conf/cvpr/2023w db/conf/cvpr/cvprw2023.html#ZhangGLZA23 Lei Gao Xinnan Zhang Xian Wu 0001 Shen Ge Yefeng Zheng 0001 Dialogue Medical Information Extraction with Medical-Item Graph and Dialogue-Status Enriched Representation. 13311-13321 2023 EMNLP (Findings) https://doi.org/10.18653/v1/2023.findings-emnlp.888 https://aclanthology.org/2023.findings-emnlp.888 conf/emnlp/2023f db/conf/emnlp/emnlp2023f.html#GaoZWG023 Jinwei Xu Jingfei Jiang Shiyao Xu Lei Gao SMVAR: A Novel RNN Accelerator Based on Non-blocking Data Distribution Structure. 734-741 2023 HPCC/DSS/SmartCity/DependSys https://doi.org/10.1109/HPCC-DSS-SmartCity-DependSys60770.2023.00107 conf/hpcc/2023 db/conf/hpcc/hpcc2023.html#XuJXG23 Jing Guo Lei Gao Nanxi Li Shan Yang Jianchi Zhu Xiaoming She Jianxiu Wang Peng Chen 0028 System-level Simulation and Performance Evaluation for 6G Ultra Massive MIMO. 1-6 2023 VTC2023-Spring https://doi.org/10.1109/VTC2023-Spring57618.2023.10199530 conf/vtc/2023s db/conf/vtc/vtc2023s.html#GuoGLYZSWC23

Tuo Zhang Lei Gao Sunwoo Lee 0001 Mi Zhang 0002 Salman Avestimehr TimelyFL: Heterogeneity-aware Asynchronous Federated Learning with Adaptive Partial Training. 2023 abs/2304.06947 CoRR https://doi.org/10.48550/arXiv.2304.06947 db/journals/corr/corr2304.html#abs-2304-06947

Lei Gao Yaotang Li Zhen Wang 0004 Rui-Wu Wang Asymmetric strategy setup solve the Prisoner's Dilemma of the evolution of mutualism. 126590 2022 412 Appl. Math. Comput. https://doi.org/10.1016/j.amc.2021.126590 https://www.wikidata.org/entity/Q111265869 db/journals/amc/amc412.html#GaoLWW22

Haoxiang Qin Qidong Shen Hongyi Zhao Guozhen Qi Lei Gao Network-based analysis revealed significant interactions between risk genes of severe COVID-19 and host genes interacted with SARS-CoV-2 proteins. 2022 23 Briefings Bioinform. 1 https://doi.org/10.1093/bib/bbab372 db/journals/bib/bib23.html#QinSZQG22

Nian Yu Ruiheng Li Wenxin Kong Lei Gao Xialan Wu Enci Wang A hybrid grid-based finite-element approach for three-dimensional magnetotelluric forward modeling in general anisotropic media. 105035 2022 159 Comput. Geosci. https://doi.org/10.1016/j.cageo.2022.105035 db/journals/gandc/gandc159.html#YuLKGWW22

Tuo Zhang Lei Gao Chaoyang He 0001 Mi Zhang 0002 Bhaskar Krishnamachari Amir Salman Avestimehr Federated Learning for the Internet of Things: Applications, Challenges, and Opportunities. 24-29 2022 5 IEEE Internet Things Mag. 1 https://doi.org/10.1109/IOTM.004.2100182 db/journals/iotm/iotm5.html#ZhangGHZKA22

Kuikui Ma Lei Gao The solution theory for the fractional hybrid q-difference equations. 2971-2982 2022 October 68 J. Appl. Math. Comput. 5 https://doi.org/10.1007/s12190-021-01650-6 db/journals/jamc/jamc68.html#MaG22

Lei Gao Xiao-Cun Chen Yin Liu Jun-Chi Liu Huai-Min Zhou Field Test Study on Deformation Monitoring of Antifloating Anchor Using Optic Fiber Sensor. 1-10 2022 2022 J. Sensors https://doi.org/10.1155/2022/3755430 db/journals/js/js2022.html#GaoCLLZ22

Jingfei Jiang Tao Xiao Jinwei Xu Dong Wen 0004 Lei Gao Yong Dou A low-latency LSTM accelerator using balanced sparsity based on FPGA. 104417 2022 March 89 Microprocess. Microsystems https://doi.org/10.1016/j.micpro.2021.104417 db/journals/mam/mam89.html#JiangXXWGD22

Yong He 0011 Guojun Cai Lei Gao Huan He Effect of Particle Size and Constraint Conditions on Single Particle Strength of Carbonate Sand. 765 2022 22 Sensors 3 https://doi.org/10.3390/s22030765 db/journals/sensors/sensors22.html#HeCGH22

Lei Gao Yingbao Zhao Jingchang Han Huixian Liu Research on Multi-View 3D Reconstruction Technology Based on SFM. 4366 2022 22 Sensors 12 https://doi.org/10.3390/s22124366 db/journals/sensors/sensors22.html#GaoZHL22

Dong Wang Qinhe Gao Zhihao Liu Yao Ding 0010 Tong Huang Lei Gao Evaluation of Vehicle Camouflage Effectiveness Under a Complex Background Based on the Time-Limited Search Model. 6133-6143 2022 15 IEEE J. Sel. Top. Appl. Earth Obs. Remote. Sens. https://doi.org/10.1109/JSTARS.2022.3192351 db/journals/staeors/staeors15.html#WangGLDHG22

Mengxuan Li 0004 Jingshan Han Lei Gao Zhi Yang Yangzhe Chen Liu Huang Research on Fatigue Assessment Algorithm based on ECG and Multi-source Physiological Signals. 350-355 2022 AIIPCC https://doi.org/10.1109/AIIPCC57291.2022.00080 conf/aiipcc/2022 db/conf/aiipcc/aiipcc2022.html#LiHGYCH22 Yafei Li Lei Gao Haobo Sun Huiling Li Qingshun Wu PRID: An Efficient Pub/Sub Ride Hitching System. 4921-4925 2022 CIKM https://doi.org/10.1145/3511808.3557213 conf/cikm/2022 db/conf/cikm/cikm2022.html#LiGSLW22 Yihong Wang Lei Gao Fingertip detection based on shapelet. 454-458 2022 EITCE https://doi.org/10.1145/3573428.3573507 conf/eitce/2022 db/conf/eitce/eitce2022.html#WangG22 Shiyao Xu Jingfei Jiang Jinwei Xu Chaorun Liu Yuanhong He Xiaohang Liu Lei Gao Sparkle: A High Efficient Sparse Matrix Multiplication Accelerator for Deep Learning. 479-486 2022 ICCD https://doi.org/10.1109/ICCD56317.2022.00077 conf/iccd/2022 db/conf/iccd/iccd2022.html#XuJXLHLG22 Lei Gao Hongming Bai Zhenhua Yang Research on MEMS-based Multi-characteristic Parameter Monitoring System for Power Transmission and Distribution Line Pole and Tower. 44-49 2022 ICCSIE https://doi.org/10.1145/3558819.3558827 conf/iccsie/2022 db/conf/iccsie/iccsie2022.html#GaoBY22 Hongming Bai Lei Gao Zhenhua Yang Development and Application of Attitude Sensor-based Monitoring System for Power Transmission and Distribution Line Pole and Tower. 50-54 2022 ICCSIE https://doi.org/10.1145/3558819.3558828 conf/iccsie/2022 db/conf/iccsie/iccsie2022.html#BaiGY22 Guanghua Lu Zenghai Wang Wei Zhang 0234 Rui Hou Mingbo Liu Lei Gao Yingxue Sun Lijun Ma Jie Yang Transmission Line Fault Location Method Based on Edge Calculation. 303-306 2022 ICITEE https://doi.org/10.1145/3582935.3582983 conf/icitee/2022 db/conf/icitee/icitee2022.html#LuWZHLGSMY22 Xiaohang Liu Jingfei Jiang Jinwei Xu Lei Gao Evaluating a New Attention Framework Based on Matrix Blocking for Attention Models on FPGAs. 607-615 2022 ICTAI https://doi.org/10.1109/ICTAI56018.2022.00095 conf/ictai/2022 db/conf/ictai/ictai2022.html#LiuJXG22 Nan Chen Jianfeng Cai 0002 Lei Gao Decision Analysis Considering Government Double Subsidy and CSR under Green Technology R&D Uncertainty. 822-826 2022 IEEM https://doi.org/10.1109/IEEM55944.2022.9989856 conf/ieem/2022 db/conf/ieem/ieem2022.html#ChenCG22 Lei Gao Jianfeng Cai 0002 Zhengfeng Li A Review of Innovation Alliances from Game Theory Perspective. 1316-1320 2022 IEEM https://doi.org/10.1109/IEEM55944.2022.9989668 conf/ieem/2022 db/conf/ieem/ieem2022.html#GaoCL22 Feng Yun Yunkun Lin Lou Yunfei Lei Gao Vaibhav Gera Boxuan Li Vennela Chowdary Nekkanti Aditya Rajendra Pharande Kunal Sheth Meghana Thommondru Guizhong Ye Sandeep Gupta 0001 Fault-coverage Maximizing March Tests for Memory Testing. 529-533 2022 ITC https://doi.org/10.1109/ITC50671.2022.00066 conf/itc/2022 db/conf/itc/itc2022.html#YunLYGGLNPSTYG22 Huiling Li Lei Gao Hua Wang Mingliang Xu 0001 Yafei Li Human-in-the-loop Real-time Task Allocation. 518-523 2022 MDM https://doi.org/10.1109/MDM55031.2022.00109 conf/mdm/2022 db/conf/mdm/mdm2022.html#LiGWXL22 Honghua Zhao Chao Wang 0118 Lei Gao Baolu Cao Xianming Song Automatic accurate positioning and experimental research of robot target based on optical navigator. 452-456 2022 RICAI https://doi.org/10.1145/3584376.3584458 https://www.wikidata.org/entity/Q130880313 conf/ricai/2022 db/conf/ricai/ricai2022.html#ZhaoWGCS22 Qianyuan Zou Huidong Bai Lei Gao Allan Fowler Mark Billinghurst Asymmetric interfaces with stylus and gesture for VR sketching. 968-969 2022 VR Workshops https://doi.org/10.1109/VRW55335.2022.00335 conf/vr/2022w db/conf/vr/vr2022w.html#ZouBGFB22

Rongyan Wang Zhian Zheng Xiufeng Lu Lei Gao Dalong Jiang Zimei Zhang Design, simulation and test of roller comb type Chrysanthemum (Dendranthema morifolium Ramat) picking machine. 106295 2021 187 Comput. Electron. Agric. https://doi.org/10.1016/j.compag.2021.106295 db/journals/cea/cea187.html#WangZLGJZ21

Lei Gao Yuanwen Song Bo Zhao 0012 3D Visualization Monitoring and Early Warning of Surface Deformation in Subsidence Area Based on GIS. 6675241:1-6675241:16 2021 2021 Complex. https://doi.org/10.1155/2021/6675241 db/journals/complexity/complexity2021.html#GaoSZ21

Lei Gao Yazhou Zhou Kairui Guo Yong Huang Xiaofan Zhu Determining the weights of influencing factors of construction lands with a neural network algorithm: a case study based on Ya'an City. 1973-1985 2021 14 Earth Sci. Informatics 4 https://doi.org/10.1007/s12145-021-00657-8 db/journals/esi/esi14.html#GaoZGHZ21

Yue Pan Liang Chen Ju Wang Hongsu Ma Shuling Cai Shiku Pu Jianli Duan Lei Gao Erbing Li Research on deformation prediction of tunnel surrounding rock using the model combining firefly algorithm and nonlinear auto-regressive dynamic neural network. 1443-1453 2021 37 Eng. Comput. 2 https://doi.org/10.1007/s00366-019-00894-y https://www.wikidata.org/entity/Q126557953 db/journals/ewc/ewc37.html#PanCWMCPDGL21

Xinxin Wang Xin Ma 0029 Gaobo Wei Weirui Ma Zhen Zhang 0039 Xuepeng Chen Lei Gao Zhenbo Liu Yue Yuan Lizhi Yi Jun Wang 0113 Toshinobu Tokumoto Junjiu Huang Dahua Chen Jian Zhang Jiang Liu 0016 The Role of DNA Methylation Reprogramming during Sex Determination and Transition in Zebrafish. 48-63 2021 19 Genom. Proteom. Bioinform. 1 https://doi.org/10.1016/j.gpb.2020.10.004 db/journals/gpb/gpb19.html#WangMWMZCGLYYWT21

Haifeng Wan Lei Gao Manman Su Qinglong You Hui Qu Qirun Sun A Novel Neural Network Model for Traffic Sign Detection and Recognition under Extreme Conditions. 9984787:1-9984787:16 2021 2021 J. Sensors https://doi.org/10.1155/2021/9984787 db/journals/js/js2021.html#WanGSYQS21

Lei Gao Zhongquan Xu Quan Wang Zhenlei Zhang Ping Li Model Test Study on Deformation of Snowflake Shaped Steel Sheet Pile Based on OFDR. 7062 2021 21 Sensors 21 https://doi.org/10.3390/s21217062 db/journals/sensors/sensors21.html#GaoXWZL21

Hongjie Wu Huajing Ling Lei Gao Qiming Fu 0001 Weizhong Lu Yijie Ding Min Jiang 0009 Haiou Li Empirical Potential Energy Function Toward ab Initio Folding G Protein-Coupled Receptors. 1752-1762 2021 18 IEEE ACM Trans. Comput. Biol. Bioinform. 5 https://doi.org/10.1109/TCBB.2020.3008014 https://www.wikidata.org/entity/Q98200741 db/journals/tcbb/tcbb18.html#WuLGFLDJL21

Lei Gao Yulong Wang 0001 Tongcun Liu Jingyu Wang 0001 Lei Zhang 0094 Jianxin Liao Question-Driven Span Labeling Model for Aspect-Opinion Pair Extraction. 12875-12883 2021 AAAI https://doi.org/10.1609/aaai.v35i14.17523 conf/aaai/2021 db/conf/aaai/aaai2021.html#GaoWLWZL21 Chen Guo Kun Zhang 0031 Jingying Chen 0001 Ruyi Xu Lei Gao Design and application of facial expression analysis system in empathy ability of children with autism spectrum disorder. 319-325 2021 FedCSIS https://doi.org/10.15439/2021F91 conf/fedcsis/2021 db/conf/fedcsis/fedcsis2021.html#GuoZCXG21 Lei Gao Research on Online Learning Behavior in China: Stages, Models and Hotspots. 92-97 2021 ICCSE https://doi.org/10.1109/ICCSE51940.2021.9569402 conf/iccse2/2021 db/conf/iccse2/iccse2021.html#Gao21 Lei Gao Linyue Bai Fei Shao Qingna Ma Ming Ni Teaching Reform of Steel Structure Curriculum Basing on Study-Group Method and SPOC Platform. 5-9 2021 ICEIT https://doi.org/10.1109/ICEIT51700.2021.9375566 conf/iceit/2021 db/conf/iceit/iceit2021.html#GaoBSMN21 JinHong Li Jian Yang Lei Gao Lu Wei Fuqi Mao Dynamic Spatial-Temporal Graph Convolutional GRU Network for Traffic Forecasting. 19-24 2021 ICSCC https://doi.org/10.1145/3510362.3510366 conf/icscc/2021 db/conf/icscc/icscc2021.html#LiYGWM21 Tuo Zhang Chaoyang He 0001 Tianhao Ma Lei Gao Mark Ma Salman Avestimehr Federated Learning for Internet of Things. 413-419 2021 SenSys https://doi.org/10.1145/3485730.3493444 https://www.wikidata.org/entity/Q130969278 conf/sensys/2021 db/conf/sensys/sensys2021.html#Zhang0MGMA21

Tuo Zhang Lei Gao Chaoyang He 0001 Mi Zhang 0002 Bhaskar Krishnamachari Salman Avestimehr Federated Learning for Internet of Things: Applications, Challenges, and Opportunities. 2021 abs/2111.07494 CoRR https://arxiv.org/abs/2111.07494 db/journals/corr/corr2111.html#abs-2111-07494

Yanjie Zeng Xinsha Fu Lei Gao Jiawei Zhu Haifeng Li 0007 Yuheng Li Robust Multivehicle Tracking With Wasserstein Association Metric in Surveillance Videos. 47863-47876 2020 8 IEEE Access https://doi.org/10.1109/ACCESS.2020.2978539 db/journals/access/access8.html#ZengFGZLL20

Yonghui Nie Zhunhang Wang Lei Gao Jiang Li 0003 Yan Zhao Frequency-Weighted Residual Truncation and Padé Approximant for Model Reduction of Power System with Constant Time Delay. 63018-63026 2020 8 IEEE Access https://doi.org/10.1109/ACCESS.2020.2984528 db/journals/access/access8.html#NieWGLZ20

Lili Wan Qiuping Peng Yong Tian 0001 Lei Gao Bojia Ye Airport capacity evaluation based on air traffic activities big data. 227 2020 2020 EURASIP J. Wirel. Commun. Netw. 1 https://doi.org/10.1186/s13638-020-01851-w db/journals/ejwcn/ejwcn2020.html#WanPTGY20

Danyang Cao Zhixin Chen Lei Gao An improved object detection algorithm based on multi-scaled and deformable convolutional neural networks. 14 2020 10 Hum. centric Comput. Inf. Sci. https://doi.org/10.1186/s13673-020-00219-9 db/journals/hcis/hcis10.html#CaoCG20

Lei Gao Thomas G. Calderon Fengchun Tang Public companies' cybersecurity risk disclosures. 100468 2020 38 Int. J. Account. Inf. Syst. https://doi.org/10.1016/j.accinf.2020.100468 db/journals/ijais/ijais38.html#GaoCT20

Min Wang 0031 Ying-Yi Zhang Fan Min 0001 Li-ping Deng Lei Gao A two-stage density clustering algorithm. 17797-17819 2020 24 Soft Comput. 23 https://doi.org/10.1007/s00500-020-05028-x db/journals/soco/soco24.html#WangZMDG20

Fei Yu 0009 Lei Gao Li Liu 0041 Shuai Qian Shuo Cai Yun Song A 1 V, 0.53 ns, 59 μW Current Comparator Using Standard 0.18 μm CMOS Technology. 843-851 2020 111 Wirel. Pers. Commun. 2 https://doi.org/10.1007/s11277-019-06888-9 db/journals/wpc/wpc111.html#YuGLQCS20

Yixing Huang Lei Gao Alexander Preuhs Andreas K. Maier Field of View Extension in Computed Tomography Using Deep Learning Prior. 186-191 2020 Bildverarbeitung für die Medizin https://doi.org/10.1007/978-3-658-29267-6_40 conf/bildmed/2020 db/conf/bildmed/bildmed2020.html#HuangGPM20 Xinhua Lv Lei Gao Modal Parameter Identification of Civil Engineering Structures Based on Numerical Simulation. 638-641 2020 ICITEE https://doi.org/10.1145/3452940.3453064 https://www.wikidata.org/entity/Q130950350 conf/icitee/2020 db/conf/icitee/icitee2020.html#LvG20 Lei Gao Huidong Bai Mark Billinghurst Robert W. Lindeman User Behaviour Analysis of Mixed Reality Remote Collaboration with a Hybrid View Interface. 629-638 2020 OZCHI https://doi.org/10.1145/3441000.3441038 conf/ozchi/2020 db/conf/ozchi/ozchi2020.html#GaoBBL20 Lei Gao Yanzhao Hou Xiaofeng Tao 0001 Min Zhu Energy-Efficient Power Control and Resource Allocation for V2V Communication. 1-6 2020 WCNC https://doi.org/10.1109/WCNC45663.2020.9120612 conf/wcnc/2020 db/conf/wcnc/wcnc2020.html#GaoHTZ20 Min Zhu Yanzhao Hou Xiaofeng Tao 0001 Tengfei Sui Lei Gao Joint Optimal Allocation of Wireless Resource and MEC Computation Capability in Vehicular Network. 1-6 2020 WCNC Workshops https://doi.org/10.1109/WCNCW48565.2020.9124737 conf/wcnc/2020w db/conf/wcnc/wcncw2020.html#ZhuHTSG20

Lei Gao Mingxiang Chen Qichang Chen Ganzhong Luo Nuoyi Zhu Zhixin Liu Learn to Design the Heuristics for Vehicle Routing Problem. 2020 abs/2002.08539 CoRR https://arxiv.org/abs/2002.08539 db/journals/corr/corr2002.html#abs-2002-08539

Mingxiang Chen Lei Gao Qichang Chen Zhixin Liu Dynamic Partial Removal: A Neural Network Heuristic for Large Neighborhood Search. 2020 abs/2005.09330 CoRR https://arxiv.org/abs/2005.09330 db/journals/corr/corr2005.html#abs-2005-09330

Mingxiang Chen Qichang Chen Lei Gao Yilin Chen Zhecheng Wang Predicting Geographic Information with Neural Cellular Automata. 2020 abs/2009.09347 CoRR https://arxiv.org/abs/2009.09347 db/journals/corr/corr2009.html#abs-2009-09347

Xu Zhang 0009 Yunlong Chen Yixian Wang Xiaobing Zha Shuai Yue Xueting Cheng Lei Gao Deloading Power Coordinated Distribution Method for Frequency Regulation by Wind Farms Considering Wind Speed Differences. 122573-122582 2019 7 IEEE Access https://doi.org/10.1109/ACCESS.2019.2938596 db/journals/access/access7.html#ZhangCWZYCG19

Zhenglin Zhang YangYang Sun Qinghua Zhang Jianli Duan Lei Gao Applications of optical frequency-domain reflectometry technology in strain-deformed configuration conversion of structural surface deformed configuration measurement. 2019 15 Int. J. Distributed Sens. Networks 11 https://doi.org/10.1177/1550147719891636 https://www.wikidata.org/entity/Q126670008 db/journals/ijdsn/ijdsn15.html#ZhangSZDG19

Lei Gao Cong Wu Lin Liu AUSPP: A universal short-read pre-processing package. 1950037:1-1950037:11 2019 17 J. Bioinform. Comput. Biol. 6 https://doi.org/10.1142/S0219720019500379 https://www.wikidata.org/entity/Q89530339 db/journals/jbcb/jbcb17.html#GaoWL19

Lei Gao Alisa G. Brink A Content Analysis of the Privacy Policies of Cloud Computing Services. 93-115 2019 33 J. Inf. Syst. 3 https://doi.org/10.2308/isys-52188 db/journals/jisys/jisys33.html#GaoB19

Danyang Cao Menggui Zhu Lei Gao An image caption method based on object detection. 35329-35350 2019 78 Multim. Tools Appl. 24 https://doi.org/10.1007/s11042-019-08116-9 https://www.wikidata.org/entity/Q127306692 db/journals/mta/mta78.html#CaoZG19

Shuang Liu 0002 Hongli Xu Yang Lin Lei Gao Visual Navigation for Recovering an AUV by Another AUV in Shallow Water. 1889 2019 19 Sensors 8 https://doi.org/10.3390/s19081889 https://www.wikidata.org/entity/Q64252047 db/journals/sensors/sensors19.html#LiuXLG19

Prasanth Sasikumar Lei Gao Huidong Bai Mark Billinghurst Wearable RemoteFusion: A Mixed Reality Remote Collaboration System with Local Eye Gaze and Remote Hand Gesture Sharing. 393-394 2019 ISMAR Adjunct https://doi.org/10.1109/ISMAR-Adjunct.2019.000-3 conf/ismar/2019a db/conf/ismar/ismar2019a.html#SasikumarGBB19 Lei Gao Prafulla Kumar Choubey Ruihong Huang Modeling Document-level Causal Structures for Event Causal Relation Identification. 1808-1817 2019 NAACL-HLT (1) https://doi.org/10.18653/v1/n19-1179 https://aclanthology.org/N19-1179/ conf/naacl/2019-1 db/conf/naacl/naacl2019-1.html#GaoCH19 Ning Gao Xiaodong Xu 0001 Yanzhao Hou Lei Gao A Mobility-aware Proactive Caching Strategy in Heterogeneous Ultra-Dense Networks. 1-7 2019 PIMRC https://doi.org/10.1109/PIMRC.2019.8904364 conf/pimrc/2019 db/conf/pimrc/pimrc2019.html#GaoXHG19 Ruolan Zhu Na Li 0001 Xiaofeng Tao 0001 Lei Gao Location Verification System for Pilot Spoofing Attack Detection. 1-5 2019 PIMRC https://doi.org/10.1109/PIMRC.2019.8904206 conf/pimrc/2019 db/conf/pimrc/pimrc2019.html#ZhuLTG19 Lei Gao Yanzhao Hou Xiaofeng Tao 0001 Min Zhu A Graph-Based Resource Sharing and Admission Control for Vehicular Networks. 1-6 2019 WCNC Workshops https://doi.org/10.1109/WCNCW.2019.8902755 conf/wcnc/2019w db/conf/wcnc/wcncw2019.html#GaoHTZ19

Yixing Huang Lei Gao Alexander Preuhs Andreas K. Maier Field of View Extension in Computed Tomography Using Deep Learning Prior. 2019 abs/1911.01178 CoRR http://arxiv.org/abs/1911.01178 db/journals/corr/corr1911.html#abs-1911-01178

Lei Gao Yixing Huang Andreas K. Maier Superpixel-Based Background Recovery from Multiple Images. 2019 abs/1911.01223 CoRR http://arxiv.org/abs/1911.01223 db/journals/corr/corr1911.html#abs-1911-01223

Heng-Ru Zhang Fan Min 0001 Yan-Xue Wu Zhuo-Lin Fu Lei Gao Magic barrier estimation models for recommended systems under normal distribution. 4678-4693 2018 48 Appl. Intell. 12 https://doi.org/10.1007/s10489-018-1237-8 db/journals/apin/apin48.html#ZhangMWFG18

Shuxuan Chen Lei Gao Quanyun Li SAR Image Despeckling by Using Nonlocal Sparse Coding Model. 3023-3045 2018 37 Circuits Syst. Signal Process. 7 https://doi.org/10.1007/s00034-017-0704-5 db/journals/cssp/cssp37.html#ChenGL18

Lei Gao Zhongliang Jing Minzhe Li Han Pan Robust adaptive filtering for extended target tracking with heavy-tailed noise in clutter. 826-835 2018 12 IET Signal Process. 7 https://doi.org/10.1049/iet-spr.2017.0249 https://www.wikidata.org/entity/Q130116910 db/journals/iet-spr/iet-spr12.html#GaoJLP18

Lei Gao Yaqiang Wang Chaoqian Li Yaotang Li Error bounds for linear complementarity problems of S-Nekrasov matrices and B-S-Nekrasov matrices. 147-159 2018 336 J. Comput. Appl. Math. https://doi.org/10.1016/j.cam.2017.12.032 db/journals/jcam/jcam336.html#GaoWLL18

Lei Gao Yanchao Ma Yonghui Nie Shiyun Xu Xiaojie Chu Long Peng Wide-Area Damping Controller Design Based on the Frequency Domain Self-Excitation Method. 2738362:1-2738362:9 2018 2018 J. Control. Sci. Eng. https://doi.org/10.1155/2018/2738362 db/journals/jocsae/jocsae2018.html#GaoMNXCP18

Xiaokai Wang Jianyou Chen Lei Gao Wenchao Chen An Iterative Zero-Offset VSP Wavefield Separating Method Based on the Error Analysis of SVD Filtering. 1164-1168 2018 15 IEEE Geosci. Remote. Sens. Lett. 8 https://doi.org/10.1109/LGRS.2018.2830375 https://www.wikidata.org/entity/Q129868260 db/journals/lgrs/lgrs15.html#WangCGC18

Lei Gao Yaqiang Wang Chaoqian Li New error bounds for the linear complementarity problem of QN-matrices. 229-242 2018 77 Numer. Algorithms 1 https://doi.org/10.1007/s11075-017-0312-2 db/journals/na/na77.html#GaoWL18

Xuanguang Ren Han Pan Zhongliang Jing Lei Gao Multi-Images Restoration Method with a Mixed-Regularization Approach for Cognitive Informatics. 423-430 2018 ICCI*CC https://doi.org/10.1109/ICCI-CC.2018.8482069 https://doi.ieeecomputersociety.org/10.1109/ICCI-CC.2018.8482069 conf/IEEEicci/2018 db/conf/IEEEicci/IEEEicci2018.html#RenPJG18 Lei Gao Wang Gao Haitao Gu Virtual Simulation Technology of 3D Obstacle Avoidance Algorithm for AUV. 117:1-117:5 2018 CSAE https://doi.org/10.1145/3207677.3278053 conf/csae/2018 db/conf/csae/csae2018.html#GaoGG18 Zhixiang Liu Zhuo Wang Xiaoping Bai Lei Gao Linearized Longitudinal Dynamic Model for Tractor Cruise Control System. 221-227 2018 ICCMS https://doi.org/10.1145/3177457.3177493 conf/iccms/2018 db/conf/iccms/iccms2018.html#LiuWBG18 Lei Gao Safe and secure SOC architecture for autonomous driving. 1 2018 VLSI-DAT https://doi.org/10.1109/VLSI-DAT.2018.8373229 conf/vlsi-dat/2018 db/conf/vlsi-dat/vlsi-dat2018.html#Gao18 Yuanjie Wu Lei Gao Simon Hoermann Robert W. Lindeman Towards Robust 3D Skeleton Tracking Using Data Fusion from Multiple Depth Sensors. 1-4 2018 VS-GAMES https://doi.org/10.1109/VS-Games.2018.8493443 https://doi.ieeecomputersociety.org/10.1109/VS-Games.2018.8493443 conf/vsgames/2018 db/conf/vsgames/vsgames2018.html#WuGHL18

Lei Gao Xingquan Liu Yu Liu 0003 Pu Wang 0005 Min Deng Qing Zhu 0012 Haifeng Li 0007 Measuring Road Network Topology Vulnerability by Ricci Curvature. 2018 abs/1811.05743 CoRR http://arxiv.org/abs/1811.05743 db/journals/corr/corr1811.html#abs-1811-05743

Lei Gao Yupeng Hu WSN中基于最小延时的数据汇集树构建与传输调度算法 (Data Aggregation Tree Construction and Transmission Scheduling Algorithm Based on Minimum Latency in Wireless Sensor Networks). 300-304 2017 44 计算机科学 Z6 https://doi.org/10.11896/j.issn.1002-137X.2017.6A.068 http://www.jsjkx.com/EN/10.11896/j.issn.1002-137X.2017.6A.068 db/journals/jsjkx/jsjkx44.html#GaoH17

Lei Gao Kai Yang Xiaorui Chen Xiangjuan Yu Study on the Deformation Measurement of the Cast-In-Place Large-Diameter Pile Using Fiber Bragg Grating Sensors. 505 2017 17 Sensors 3 https://doi.org/10.3390/s17030505 https://www.wikidata.org/entity/Q37732582 db/journals/sensors/sensors17.html#GaoYCY17

Xian-Feng Han Jesse S. Jin Ming-Jie Wang Wei Jiang 0038 Lei Gao Liping Xiao Video fire detection based on Gaussian Mixture Model and multi-color features. 1419-1425 2017 11 Signal Image Video Process. 8 https://doi.org/10.1007/s11760-017-1102-y db/journals/sivp/sivp11.html#HanJWJGX17

Xian-Feng Han Jesse S. Jin Ming-Jie Wang Wei Jiang 0038 Lei Gao Liping Xiao A review of algorithms for filtering the 3D point cloud. 103-112 2017 57 Signal Process. Image Commun. https://doi.org/10.1016/j.image.2017.05.009 db/journals/spic/spic57.html#HanJWJGX17

Danyang Cao Xue Gao Lei Gao An Improved Endpoint Detection Algorithm Based on MFCC Cosine Value. 2073-2090 2017 95 Wirel. Pers. Commun. 3 https://doi.org/10.1007/s11277-017-3958-0 db/journals/wpc/wpc95.html#CaoGG17

Danyang Cao Lina Duan Xue Gao Lei Gao Limited Constraint Problems Reasoning on Computer Based on "And/Or" Tree. 280-286 2017 CSA/CUTE https://doi.org/10.1007/978-981-10-7605-3_46 conf/csa2/2017 db/conf/csa2/csa2017.html#CaoDGG17 Lei Gao Huidong Bai Thammathip Piumsomboon Gun A. Lee Robert W. Lindeman Mark Billinghurst Real-time Visual Representations for Mixed Reality Remote Collaboration. 87-95 2017 ICAT-EGVE https://doi.org/10.2312/egve.20171344 conf/egve/2017 db/conf/egve/icat-egve2017.html#GaoBPLLB17 Kun Zhang 0031 Jintao Suo Jingying Chen 0001 Xiaodi Liu Lei Gao Design and Implementation of Fire Safety Education System on Campus based on Virtual Reality Technology. 1297-1300 2017 FedCSIS https://doi.org/10.15439/2017F376 conf/fedcsis/2017 db/conf/fedcsis/fedcsis2017.html#ZhangSCLG17 Lei Gao Peijiang Yuan Tianmiao Wang Zhenyun Shi Yong Li Shuangqian Cao Xiaonan Ji New research on SLAM algorithm based on feature matching. 1-6 2017 ICARM https://doi.org/10.1109/ICARM.2017.8273125 conf/icarm/2017 db/conf/icarm/icarm2017.html#GaoYWSLCJ17 Yuwei Qiu Huimin Ma Lei Gao Hardness Prediction for Object Detection Inspired by Human Vision. 139-150 2017 ICIG (2) https://doi.org/10.1007/978-3-319-71589-6_13 conf/icig/2017-2 db/conf/icig/icig2017-2.html#QiuMG17 Lei Gao Ling-Jiao Chen Xiao Long Chen Hui Gao Facilitating information spreading with local information in complex networks. 373-377 2017 ICNC-FSKD https://doi.org/10.1109/FSKD.2017.8393297 conf/icnc/2017 db/conf/icnc/icnc2017.html#GaoCCG17 Felix Russell Lei Gao Peter Ellison Ravi Vaidyanathan Challenges in using compliant ligaments for position estimation within robotic joints. 1471-1476 2017 ICORR https://doi.org/10.1109/ICORR.2017.8009455 https://www.wikidata.org/entity/Q47723544 conf/icorr/2017 db/conf/icorr/icorr2017.html#RussellGEV17 Lei Gao Alexis Kuppersmith Ruihong Huang Recognizing Explicit and Implicit Hate Speech Using a Weakly Supervised Two-path Bootstrapping Approach. 774-782 2017 IJCNLP(1) https://aclanthology.org/I17-1078/ conf/ijcnlp/2017-1 db/conf/ijcnlp/ijcnlp2017-1.html#GaoKH17 Yujia Li Lei Gao Wei Huang Cong Gao Min Liu Tao Zhu Evanescent field-assisted mode-locked laser based on short single-wall carbon nanotubes and photonic crystal fiber. 1-3 2017 OFC https://ieeexplore.ieee.org/document/7937407 conf/ofc/2017 db/conf/ofc/ofc2017.html#LiGHGLZ17 Lei Gao Ruihong Huang Detecting Online Hate Speech Using Context Aware Models. 260-266 2017 RANLP https://doi.org/10.26615/978-954-452-049-6_036 conf/ranlp/2017 db/conf/ranlp/ranlp2017.html#GaoH17 Huidong Bai Lei Gao Mark Billinghurst 6DoF input for hololens using vive controller. 4:1 2017 SIGGRAPH ASIA Mobile Graphics and Interactive Applications https://doi.org/10.1145/3132787.3132814 conf/siggrapha/2017mobile db/conf/siggrapha/siggrapha2017mobile.html#BaiGB17 Lei Gao Huidong Bai Rob Lindeman 0001 Mark Billinghurst Static local environment capturing and sharing for MR remote collaboration. 17:1-17:6 2017 SIGGRAPH ASIA Mobile Graphics and Interactive Applications https://doi.org/10.1145/3132787.3139204 conf/siggrapha/2017mobile db/conf/siggrapha/siggrapha2017mobile.html#GaoBLB17

Xin Lin Haifeng Li 0007 Yan Zhang Lei Gao Ling Zhao 0005 Min Deng A Probabilistic Embedding Clustering Method for Urban Structure Detection. 2017 abs/1707.03608 CoRR http://arxiv.org/abs/1707.03608 db/journals/corr/corr1707.html#LinLZGZD17

Lei Gao Alexis Kuppersmith Ruihong Huang Recognizing Explicit and Implicit Hate Speech Using a Weakly Supervised Two-path Bootstrapping Approach. 2017 abs/1710.07394 CoRR http://arxiv.org/abs/1710.07394 db/journals/corr/corr1710.html#abs-1710-07394

Lei Gao Ruihong Huang Detecting Online Hate Speech Using Context Aware Models. 2017 abs/1710.07395 CoRR http://arxiv.org/abs/1710.07395 db/journals/corr/corr1710.html#abs-1710-07395

Lei Gao Shuo Zhang 0012 Ziyao Liu Jinyong Lin Shuai Wang 0013 Chengwen Xing An overview of multi-antenna technologies for space-ground integrated networks. 121301:1-121301:18 2016 59 Sci. China Inf. Sci. 12 https://doi.org/10.1007/s11432-016-0588-8 db/journals/chinaf/chinaf59.html#GaoZLLWX16

Han Fujun Lei Gao Hongyong Yang Sampling control on collaborative flocking motion of discrete-time system with time-delays. 242-249 2016 216 Neurocomputing https://doi.org/10.1016/j.neucom.2016.07.041 db/journals/ijon/ijon216.html#FujunLY16

Lei Gao Yanli Zeng Xueying Zhang Lingpeng Meng Comparative studies on group III σ-hole and π-hole interactions. 1321-1327 2016 37 J. Comput. Chem. 14 https://doi.org/10.1002/jcc.24347 https://www.wikidata.org/entity/Q87416513 db/journals/jcc/jcc37.html#GaoZZM16

Qinghua Zhang Yuan Wang YangYang Sun Lei Gao Zhenglin Zhang Wenyuan Zhang Pengchong Zhao Yin Yue Using Custom Fiber Bragg Grating-Based Sensors to Monitor Artificial Landslides. 1417 2016 16 Sensors 9 https://doi.org/10.3390/s16091417 https://www.wikidata.org/entity/Q37288966 db/journals/sensors/sensors16.html#ZhangWSGZZZY16

Xian Zhou 0001 Kangping Zhong Jiahao Huo Yiguang Wang Liang Wang 0048 Jiajing Tu Yanfu Yang Lei Gao Li Zeng Changyuan Yu Alan Pak Tao Lau Chao Lu 0001 112-Gbit/s PDM-PAM4 transmission over 80-km SMF using digital coherent detection without optical amplifier. 1-3 2016 CSNDSP https://doi.org/10.1109/CSNDSP.2016.7573937 conf/csndsp/2016 db/conf/csndsp/csndsp2016.html#ZhouZHWWTYGZYLL16 Na Ruan Qi Hu Lei Gao Haojin Zhu Qingshui Xue Weijia Jia 0001 Jingyu Cui A Traffic Based Lightweight Attack Detection Scheme for VoLTE. 1-6 2016 GLOBECOM https://doi.org/10.1109/GLOCOM.2016.7841555 conf/globecom/2016 db/conf/globecom/globecom2016.html#RuanHGZXJC16 Lei Gao Peijiang Yuan Tianmiao Wang Zhenyun Shi Shuangqian Cao Xiaonan Ji Automatic recognition about Pallet based on tracking algorithm of ladar and SLAM. 196-201 2016 ICARM https://doi.org/10.1109/ICARM.2016.7606918 conf/icarm/2016 db/conf/icarm/icarm2016.html#GaoYWSCJ16 Shuangqian Cao Peijiang Yuan Zhenyun Shi Xiaonan Ji Lei Gao Tianmiao Wang A bilingual teaching method combined with drilling robot for mechatronics course. 467-472 2016 ICARM https://doi.org/10.1109/ICARM.2016.7606965 conf/icarm/2016 db/conf/icarm/icarm2016.html#CaoYSJGW16 Xiaonan Ji Peijiang Yuan Zhenyun Shi Jiting Li Tianmiao Wang Shuangqian Cao Lei Gao An effective self-adaptive mean filter for mixed noise. 484-489 2016 ICARM https://doi.org/10.1109/ICARM.2016.7606968 conf/icarm/2016 db/conf/icarm/icarm2016.html#JiYSLWCG16 Lei Gao Na Ruan Haojin Zhu Efficient and secure message authentication in cooperative driving: A game-theoretic approach. 1-6 2016 ICC https://doi.org/10.1109/ICC.2016.7510673 conf/icc/2016 db/conf/icc/icc2016.html#GaoRZ16 Na Ruan Lei Gao Haojin Zhu Weijia Jia 0001 Xiang Li Qi Hu Toward Optimal DoS-Resistant Authentication in Crowdsensing Networks via Evolutionary Game. 364-373 2016 ICDCS https://doi.org/10.1109/ICDCS.2016.66 https://doi.ieeecomputersociety.org/10.1109/ICDCS.2016.66 conf/icdcs/2016 db/conf/icdcs/icdcs2016.html#RuanGZJLH16 Wei Wang 0070 Lei Gao Yu-Xiao Zhu Hui Gao Effects of mass medias on the dynamics of social contagions. 311-315 2016 ICNC-FSKD https://doi.org/10.1109/FSKD.2016.7603192 conf/icnc/2016 db/conf/icnc/icnc2016.html#WangGZG16 Ming-Jie Wang Jesse S. Jin Yifei Jing Xian-Feng Han Lei Gao Liping Xiao The Improved Canny Edge Detection Algorithm Based on an Anisotropic and Genetic Algorithm. 115-124 2016 IGTA https://doi.org/10.1007/978-981-10-2260-9_14 conf/igta/2016 db/conf/igta/igta2016.html#WangJJHGX16 Mingjie Wang 0002 Jesse S. Jin Xian-Feng Han Wei Jiang 0038 Yifei Jing Lei Gao Liping Xiao An Algorithm of Detecting Moving Foreground Based on an Improved Gaussian Mixture Model. 125-136 2016 IGTA https://doi.org/10.1007/978-981-10-2260-9_15 conf/igta/2016 db/conf/igta/igta2016.html#WangJHJJGX16 Lei Gao Huidong Bai Gun A. Lee Mark Billinghurst An oriented point-cloud view for MR remote collaboration. 8:1-8:4 2016 SIGGRAPH ASIA Mobile Graphics and Interactive Applications https://doi.org/10.1145/2999508.2999531 conf/siggraph/2016asiamobile db/conf/siggraph/siggraph2016asiamobile.html#GaoBLB16

Lei Gao Wei Wang 0070 Liming Pan Ming Tang 0004 Hai-Feng Zhang 0003 Effective information spreading based on local information in correlated networks. 2016 abs/1606.05408 CoRR http://arxiv.org/abs/1606.05408 db/journals/corr/corr1606.html#GaoWPTZ16

Yanshan Zhang Fook Fah Yap Jasleen Singh Ting Lei Lei Gao A knowledge-based web platform for collaborative physical system modeling and simulation. 23-35 2015 23 Comput. Appl. Eng. Educ. 1 https://doi.org/10.1002/cae.21572 https://www.wikidata.org/entity/Q125388160 db/journals/caee/caee23.html#ZhangYSLG15

Lei Gao Baoquan Ji Gangqiang Kong Xu Huang Mingkun Li Ali H. Mahfouz Distributed Measurement of Temperature for PCC Energy Pile Using BOFDA. 610473:1-610473:6 2015 2015 J. Sensors https://doi.org/10.1155/2015/610473 https://www.wikidata.org/entity/Q59114469 db/journals/js/js2015.html#GaoJKHLM15

Lei Gao Pengpeng Zhao 0001 Victor S. Sheng Zhixu Li An Liu 0002 Jian Wu 0002 Zhiming Cui 0002 EPEMS: An Entity Matching System for E-Commerce Products. 871-874 2015 APWeb https://doi.org/10.1007/978-3-319-25255-1_74 conf/apweb/2015 db/conf/apweb/apweb2015.html#GaoZSLLWC15 Zenghui Yuan Ying Chen 0007 Lei Gao A simulation-based method for EMR assessment of aviation electronic products. 1017-1021 2015 IEEM https://doi.org/10.1109/IEEM.2015.7385802 conf/ieem/2015 db/conf/ieem/ieem2015.html#YuanCG15

Lei Gao Chaoqian Li Yaotang Li A New Upper Bound on the Infinity Norm of the Inverse of Nekrasov Matrices. 2014 2014 J. Appl. Math. https://doi.org/10.1155/2014/708128 https://www.wikidata.org/entity/Q59051945 db/journals/jam/jam2014.html#GaoLL14 708128:1-708128:8

Hongchang Ke Hongbin Sun Lei Gao Hui Wang 0040 A Video Image Compression Method based on Visually Salient Features. 333-339 2014 12 J. Digit. Inf. Manag. 5 http://dline.info/fpaper/jdim/v12i5/7.pdf db/journals/jdim/jdim12.html#KeSGW14

Yanpeng Li Xiang Li 0014 Hongqiang Wang 0001 Yiping Chen Zhaowen Zhuang Yongqiang Cheng 0002 Bin Deng 0002 Liandong Wang Yonghu Zeng Lei Gao A Compact Methodology to Understand, Evaluate, and Predict the Performance of Automatic Target Recognition. 11308-11350 2014 14 Sensors 7 https://doi.org/10.3390/s140711308 https://www.wikidata.org/entity/Q30430686 db/journals/sensors/sensors14.html#LiLWCZ0DWZG14

Bing Kang Fu Liu 0001 Lei Gao A New Approach to Palmprint Mainline Restoration Based on Gaussian Distribution. 225-233 2014 CCBR https://doi.org/10.1007/978-3-319-12484-1_25 conf/ccbr/2014 db/conf/ccbr/ccbr2014.html#KangLG14 Fu Liu 0001 Lei Gao Wenwen Li Huiying Liu A New Hand Shape Recognition Algorithm Unrelated to the Finger Root Contour. 522-529 2014 CCBR https://doi.org/10.1007/978-3-319-12484-1_60 conf/ccbr/2014 db/conf/ccbr/ccbr2014.html#LiuGLL14 Lei Gao Wei Liu Runxin Niu Yanbiao Sun Yu Xin Huawei Liang Moving vehicle detection in dynamical scene using vector quantization. 725-729 2014 Intelligent Vehicles Symposium https://doi.org/10.1109/IVS.2014.6856410 conf/ivs/2014 db/conf/ivs/ivs2014.html#GaoLNSXL14

Chaogan Yan Qingyang Li 0004 Lei Gao PRN: a preprint service for catalyzing R-fMRI and neuroscience related studies. 313 2014 3 F1000Research https://doi.org/10.12688/f1000research.5951.1 https://www.wikidata.org/entity/Q28652089 db/journals/f1000research/f1000research3.html#YanLG14

Ming-che Lai Lei Gao Nong Xiao 0001 Zhiying Wang 0003 An accurate and highly-efficient performance evaluation approach based on queuing model for on-chip network. 1-20 2013 56 Sci. China Inf. Sci. 7 https://doi.org/10.1007/s11432-012-4648-x db/journals/chinaf/chinaf56.html#LaiGXW13

Huidong Bai Lei Gao Mark Billinghurst Poster: Markerless fingertip-based 3D interaction for handheld augmented reality in a small workspace. 129-130 2013 3DUI https://doi.org/10.1109/3DUI.2013.6550212 https://doi.ieeecomputersociety.org/10.1109/3DUI.2013.6550212 conf/3dui/2013 db/conf/3dui/3dui2013.html#BaiGB13 Lei Gao Yuan-Dong Lan Transmission Distance Estimation and Testing for 2.4GHz ZigBee Applications. 27-32 2013 conf/eidwt/2013 EIDWT https://doi.org/10.1109/EIDWT.2013.10 https://doi.ieeecomputersociety.org/10.1109/EIDWT.2013.10 db/conf/eidwt/eidwt2013.html#GaoL13 Yuan-Dong Lan Lei Gao A New Model of Combining Multiple Classifiers Based on Neural Network. 154-159 2013 conf/eidwt/2013 EIDWT https://doi.org/10.1109/EIDWT.2013.32 https://doi.ieeecomputersociety.org/10.1109/EIDWT.2013.32 db/conf/eidwt/eidwt2013.html#LanG13 Lei Gao Alan Bourke John Nelson Sensor Positioning for Activity Recognition Using Multiple Accelerometer-Based Sensors. 2013 ESANN https://www.esann.org/sites/default/files/proceedings/legacy/es2013-76.pdf conf/esann/2013 db/conf/esann/esann2013.html#GaoBN13 Moufa Hu Lei Gao Zhiyong Zhang Comprehensive evaluation on ISAR anti-jamming effectiveness via ELECTRE-III. 979-984 2013 ICIA https://doi.org/10.1109/ICInfA.2013.6720437 conf/icinfa/2013 db/conf/icinfa/icinfa2013.html#HuGZ13 Lizhong Qiu Lei Gao Yongke Ding Yuanxiang Li Heping Lu Wenxian Yu Change detection method using a new difference image for remote sensing images. 4293-4296 2013 IGARSS https://doi.org/10.1109/IGARSS.2013.6723783 conf/igarss/2013 db/conf/igarss/igarss2013.html#QiuGDLLY13 Huidong Bai Lei Gao Jihad El-Sana Mark Billinghurst Markerless 3D gesture-based interaction for handheld Augmented Reality interfaces. 1-6 2013 ISMAR https://doi.org/10.1109/ISMAR.2013.6671841 https://doi.ieeecomputersociety.org/10.1109/ISMAR.2013.6671841 conf/ismar/2013 db/conf/ismar/ismar2013.html#BaiGEB13 JiuYue Hao Lei Gao Xuan Zhao Pengfei Li PengJu Xing Xinye Zhang Trajectory clustering based on length scale directive Hausdorff. 480-484 2013 ITSC https://doi.org/10.1109/ITSC.2013.6728277 conf/itsc/2013 db/conf/itsc/itsc2013.html#HaoGZLXZ13 Lei Gao Ming-che Lai Kefei Wang Zhengbin Pang A Highly-Efficient Approach to Adaptive Load Balance for Scalable TBGP. 101-110 2013 NCCET https://doi.org/10.1007/978-3-642-41635-4_11 conf/nccet/2013 db/conf/nccet/nccet2013.html#GaoLWP13 Huidong Bai Lei Gao Jihad El-Sana Mark Billinghurst Free-hand interaction for handheld augmented reality using an RGB-depth camera. 22:1-22:4 2013 SIGGRAPH ASIA Mobile Graphics and Interactive Applications https://doi.org/10.1145/2543651.2543667 conf/siggraph/2013asiamobile db/conf/siggraph/siggraph2013asiamobile.html#BaiGEB13 Huidong Bai Lei Gao Jihad El-Sana Mark Billinghurst Markerless 3D gesture-based interaction for handheld augmented reality interfaces. 22:1 2013 SIGGRAPH ASIA Mobile Graphics and Interactive Applications https://doi.org/10.1145/2543651.2543678 conf/siggraph/2013asiamobile db/conf/siggraph/siggraph2013asiamobile.html#BaiGEB13a

Xue Xiao Dongguo Li Lei Gao Xia Li 0004 Qianghu Wang Shaojun Zhang Zhicheng Liu Screening for cancer associated MiRNAs through co-gene, co-function and co-pathway analysis. 624-630 2012 42 Comput. Biol. Medicine 5 https://doi.org/10.1016/j.compbiomed.2012.02.008 https://www.wikidata.org/entity/Q83730046 db/journals/cbm/cbm42.html#XiaoLGLWZL12

Shirshanka Das Chavdar Botev Kapil Surlaker Bhaskar Ghosh Balaji Varadarajan Sunil Nagaraj David Zhang 0001 Lei Gao Jemiah Westerman Phanindra Ganti Boris Shkolnik Sajid Topiwala Alexander Pachev Naveen Somasundaram Subbu Subramaniam All aboard the Databus!: Linkedin's scalable consistent change data capture platform. 18 2012 SoCC https://doi.org/10.1145/2391229.2391247 conf/cloud/2012 db/conf/cloud/socc2012.html#DasBSGVNZGWGSTPSS12 Lei Gao Alan K. Bourke John Nelson Activity recognition using dynamic multiple sensor fusion in body sensor networks. 1077-1080 2012 EMBC https://doi.org/10.1109/EMBC.2012.6346121 https://www.wikidata.org/entity/Q86021470 conf/embc/2012 db/conf/embc/embc2012.html#GaoBN12 Roshan Sumbaly Jay Kreps Lei Gao Alex Feinberg Chinmay Soman Sam Shah Serving large-scale batch computed data with project Voldemort. 18 2012 FAST https://www.usenix.org/conference/fast12/serving-large-scale-batch-computed-data-project-voldemort conf/fast/2012 db/conf/fast/fast2012.html#SumbalyKGFSS12 Mandy Yang Xingzhou He Lei Gao Li Zhao An innovative system of health monitoring using mobile phones. 379-382 2012 Healthcom https://doi.org/10.1109/HealthCom.2012.6379442 conf/healthcom/2012 db/conf/healthcom/healthcom2012.html#YangHGZ12 Aditya Auradkar Chavdar Botev Shirshanka Das Dave De Maagd Alex Feinberg Phanindra Ganti Lei Gao Bhaskar Ghosh Kishore Gopalakrishna Brendan Harris Joel Koshy Kevin Krawez Jay Kreps Shi Lu Sunil Nagaraj Neha Narkhede Sasha Pachev Igor Perisic Lin Qiao Tom Quiggle Jun Rao Bob Schulman Abraham Sebastian Oliver Seeliger Adam Silberstein Boris Shkolnik Chinmay Soman Roshan Sumbaly Kapil Surlaker Sajid Topiwala Cuong Tran 0003 Balaji Varadarajan Jemiah Westerman Zach White David Zhang 0001 Jason Zhang Data Infrastructure at LinkedIn. 1370-1381 2012 ICDE https://doi.org/10.1109/ICDE.2012.147 https://doi.ieeecomputersociety.org/10.1109/ICDE.2012.147 https://www.wikidata.org/entity/Q57809538 conf/icde/2012 db/conf/icde/icde2012.html#AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12 Donghong Qin Jiahai Yang 0001 Jessie Hui Wang Bin Zhang 0016 Lei Gao Zhuolin Liu Multipath interdomain routing via deviation from primary path. 222-227 2012 ICOIN https://doi.org/10.1109/ICOIN.2012.6164381 https://doi.ieeecomputersociety.org/10.1109/ICOIN.2012.6164381 conf/icoin/2012 db/conf/icoin/icoin2012.html#QinYWZGL12 Lei Gao Wenchao Chen Jinghuai Gao Zero-offset VSP wavefield separation using two-step SVD method. 4407-4409 2012 IGARSS https://doi.org/10.1109/IGARSS.2012.6350396 conf/igarss/2012 db/conf/igarss/igarss2012.html#GaoCG12 Bin Zhang 0016 Jiahai Yang 0001 Jianping Wu Donghong Qin Lei Gao PCA-subspace method - Is it good enough for network-wide anomaly detection. 359-367 2012 NOMS https://doi.org/10.1109/NOMS.2012.6211919 conf/noms/2012 db/conf/noms/noms2012.html#ZhangYWQG12 Lei Gao Jiahai Yang 0001 Hui Zhang 0052 Donghong Qin Bin Zhang 0016 What's going on in Chinese IPv6 world. 534-537 2012 NOMS https://doi.org/10.1109/NOMS.2012.6211949 conf/noms/2012 db/conf/noms/noms2012.html#GaoYZQZ12

Ming-che Lai Lei Gao Two-level tries: A general acceleration structure for parallel routing table accesses. 408-417 2011 13 J. Commun. Networks 4 https://doi.org/10.1109/JCN.2011.6157461 db/journals/jcn/jcn13.html#MingcheL11

Ming-che Lai Lei Gao Sheng Ma Nong Xiao 0001 Zhiying Wang 0003 A practical low-latency router architecture with wing channel for on-chip network. 98-109 2011 35 Microprocess. Microsystems 2 https://doi.org/10.1016/j.micpro.2010.09.002 db/journals/mam/mam35.html#LaiGMXW11

Lei Gao Gaurav Mittal David Zaretsky Prith Banerjee Resource optimization and deadlock prevention while generating streaming architectures from ordinary programs. 9-16 2011 AHS https://doi.org/10.1109/AHS.2011.5963928 conf/ahs/2011 db/conf/ahs/ahs2011.html#GaoMZB11 Lei Gao Jiahai Yang 0001 Hui Zhang 0052 Bin Zhang 0016 Donghong Qin FlowInfra: A fault-resilient scalable infrastructure for network-wide flow level measurement. 1-8 2011 APNOMS https://doi.org/10.1109/APNOMS.2011.6077019 conf/apnoms/2011 db/conf/apnoms/apnoms2011.html#GaoYZZQ11 Bin Zhang 0016 Jiahai Yang 0001 Jianping Wu Donghong Qin Lei Gao MCST: Anomaly detection using feature stability for packet-level traffic. 1-8 2011 APNOMS https://doi.org/10.1109/APNOMS.2011.6077018 conf/apnoms/2011 db/conf/apnoms/apnoms2011.html#ZhangYWQG11 Lin Hua Yongbin Liu Lei Gao Dongguo Li Explore the domain features of co-regulation proteins, co-interaction proteins and co-regulation & Co-interaction proteins. 1575-1579 2011 BMEI https://doi.org/10.1109/BMEI.2011.6098598 conf/bmei/2011 db/conf/bmei/bmei2011.html#HuaLGL11 Lei Gao Alan Bourke John Nelson An efficient sensing approach using dynamic multi-sensor collaboration for activity recognition. 1-3 2011 DCOSS https://doi.org/10.1109/DCOSS.2011.5982190 https://doi.ieeecomputersociety.org/10.1109/DCOSS.2011.5982190 conf/dcoss/2011 db/conf/dcoss/dcoss2011.html#GaoBN11 Lei Gao Alan K. Bourke John Nelson A system for activity recognition using multi-sensor fusion. 7869-7872 2011 EMBC https://doi.org/10.1109/IEMBS.2011.6091939 https://www.wikidata.org/entity/Q83272010 conf/embc/2011 db/conf/embc/embc2011.html#GaoBN11 Lei Gao Theodore J. Mock Rajendra P. Srivastava An Evidential Reasoning Approach to Fraud Risk Assessment under Dempster-Shafer Theory: A General Framework. 1-10 2011 HICSS https://doi.org/10.1109/HICSS.2011.52 https://doi.ieeecomputersociety.org/10.1109/HICSS.2011.52 conf/hicss/2011 db/conf/hicss/hicss2011.html#GaoMS11 Lei Gao Gu Quan Xin Social Network Analysis on Knowledge Sharing of Scientific Groups. 71-76 2011 LISS (3) conf/liss/2011-3 db/conf/liss/liss2011-3.html#LeiX11 Lei Gao Xiaohui Yu 0001 Yang Liu 0008 Keyword Query Cleaning with Query Logs. 31-42 2011 WAIM https://doi.org/10.1007/978-3-642-23535-1_5 conf/waim/2011 db/conf/waim/waim2011.html#GaoYL11

Ming-che Lai Lei Gao Zhiying Wang Exploration and implementation of a highly efficient processor element for multimedia and signal processing domains. 374-387 2010 4 IET Comput. Digit. Tech. 5 https://doi.org/10.1049/iet-cdt.2009.0041 db/journals/iet-cdt/iet-cdt4.html#LaiGW10

Lei Gao Michael Dahlin Jiandan Zheng Lorenzo Alvisi Arun Iyengar Dual-Quorum: A Highly Available and Consistent Replication System for Edge Services. 159-174 2010 7 IEEE Trans. Dependable Secur. Comput. 2 https://doi.org/10.1109/TDSC.2008.36 http://doi.ieeecomputersociety.org/10.1109/TDSC.2008.36 db/journals/tdsc/tdsc7.html#GaoDZAI10

Lei Gao David Zaretsky Gaurav Mittal Dan Schonfeld Prith Banerjee Automatic Generation of Stream Descriptors for Streaming Architectures. 307-312 2010 ICPP https://doi.org/10.1109/ICPP.2010.38 https://doi.ieeecomputersociety.org/10.1109/ICPP.2010.38 conf/icpp/2010 db/conf/icpp/icpp2010.html#GaoZMSB10 Lei Gao Jiahai Yang 0001 Jessie Hui Wang Hui Zhang 0052 A measure of growth of user community in OSNs. 1-2 2010 IWQoS https://doi.org/10.1109/IWQoS.2010.5542712 conf/iwqos/2010 db/conf/iwqos/iwqos2010.html#GaoYWZ10 Lei Gao Guangda Li Yantao Zheng Richang Hong Tat-Seng Chua Video Reference: A Video Question Answering Engine. 799-801 2010 MMM https://doi.org/10.1007/978-3-642-11301-7_92 conf/mmm/2010 db/conf/mmm/mmm2010.html#GaoLZHC10 Lei Gao Guangzhou Zeng An Innovative Hybrid P2P Location Network for Distributed Optimal Path Planning. 148-155 2010 PDCAT https://doi.org/10.1109/PDCAT.2010.53 https://doi.ieeecomputersociety.org/10.1109/PDCAT.2010.53 conf/pdcat/2010 db/conf/pdcat/pdcat2010.html#GaoZ10 Muhammad Hamad Alizai Lei Gao Torsten Kempf Olaf Landsiedel Tools and Modeling Approaches for Simulating Hardware and Systems. 99-119 2010 Modeling and Tools for Network Simulation https://doi.org/10.1007/978-3-642-12331-3_7 books/sp/wehrle10 db/books/collections/Wehrle2010.html#AlizaiGKL10

Lei Gao Dictionary for Sparse Representation of Chirp Echo in Broadband Radar http://arxiv.org/abs/1008.0178 2010 CoRR abs/1008.0178 db/journals/corr/corr1008.html#abs-1008-0178

Lei Gao Jin-Li Guo Chao Fan Xuejiao Liu Individual and Group Dynamics in Purchasing Activity http://arxiv.org/abs/1010.3815 2010 CoRR abs/1010.3815 db/journals/corr/corr1010.html#abs-1010-3815

Rajendra P. Srivastava Lei Gao Peter R. Gillett Representation of interrelationships among binary variables under dempster-shafer theory of belief functions. 459-475 2009 24 Int. J. Intell. Syst. 4 https://doi.org/10.1002/int.20347 db/journals/ijis/ijis24.html#SrivastavaGG09

Lei Gao Jia Huang Jianjiang Ceng Rainer Leupers Gerd Ascheid Heinrich Meyr TotalProf: a fast and accurate retargetable source code profiler. 305-314 2009 CODES+ISSS https://doi.org/10.1145/1629435.1629477 conf/codes/2009 db/conf/codes/codes2009.html#GaoHCLAM09 Lei Gao Guangzhou Zeng A Novel Sequential Testing Algorithm Based on Rough-Compact Sets Theory for Multiple Fault Diagnosis. 17-23 2009 CSIE (6) https://doi.org/10.1109/CSIE.2009.42 https://doi.ieeecomputersociety.org/10.1109/CSIE.2009.42 conf/csie/2009 db/conf/csie/csie2009-6.html#GaoZ09 Ming-che Lai Lei Gao Nong Xiao 0001 Zhiying Wang 0003 An accurate and efficient performance analysis approach based on queuing model for network on chip. 563-570 2009 ICCAD https://doi.org/10.1145/1687399.1687505 https://ieeexplore.ieee.org/document/5361237/ conf/iccad/2009 db/conf/iccad/iccad2009.html#LaiGXW09 Lik Wong Nimar S. Arora Lei Gao Thuvan Hoang Jingwei Wu Oracle Streams: A High Performance Implementation for Near Real Time Asynchronous Replication. 1363-1374 2009 ICDE https://doi.org/10.1109/ICDE.2009.121 https://doi.ieeecomputersociety.org/10.1109/ICDE.2009.121 conf/icde/2009 db/conf/icde/icde2009.html#WongAGHW09 Lei Gao Ming-che Lai Zhenghu Gong An Improved Parallel Access Technology on Routing Table for Threaded BGP. 198-204 2009 ICPADS https://doi.org/10.1109/ICPADS.2009.81 https://doi.ieeecomputersociety.org/10.1109/ICPADS.2009.81 conf/icpads/2009 db/conf/icpads/icpads2009.html#GaoLG09 Lei Gao Gaurav Mittal David Zaretsky Dan Schonfeld Prithviraj Banerjee An Automated Algorithm to Generate Stream Programs. 1505-1508 2009 ISCAS https://doi.org/10.1109/ISCAS.2009.5118053 conf/iscas/2009 db/conf/iscas/iscas2009.html#GaoMZSB09 Lei Gao David Zaretsky Gaurav Mittal Dan Schonfeld Prith Banerjee A software pipelining algorithm in high-level synthesis for FPGA architectures. 297-302 2009 ISQED https://doi.org/10.1109/ISQED.2009.4810311 https://doi.ieeecomputersociety.org/10.1109/ISQED.2009.4810311 conf/isqed/2009 db/conf/isqed/isqed2009.html#GaoZMSB09

Lei Gao Zhenghu Gong Yaping Liu Ming-che Lai Wei Peng 0005 A TLP approach for BGP based on local speculation. 1772-1784 2008 51 Sci. China Ser. F Inf. Sci. 11 https://doi.org/10.1007/s11432-008-0145-7 db/journals/chinaf/chinaf51.html#GaoGLLP08

Ming-che Lai Lei Gao Wei Shi Zhiying Wang 0003 Escaping from Blocking: A Dynamic Virtual Channel for Pipelined Routers. 795-800 2008 conf/cisis/2008 CISIS https://doi.org/10.1109/CISIS.2008.46 https://doi.ieeecomputersociety.org/10.1109/CISIS.2008.46 db/conf/cisis/cisis2008.html#LaiGSW08 Lei Gao Ming-che Lai Zhenghu Gong Exploiting the Thread-Level Parallelism for BGP on Multi-core. 510-516 2008 CNSR https://doi.org/10.1109/CNSR.2008.22 https://doi.ieeecomputersociety.org/10.1109/CNSR.2008.22 conf/cnsr/2008 db/conf/cnsr/cnsr2008.html#LeiMZ08 Lei Gao Kingshuk Karuri Stefan Kraemer Rainer Leupers Gerd Ascheid Heinrich Meyr Multiprocessor performance estimation using hybrid simulation. 325-330 2008 DAC https://doi.org/10.1145/1391469.1391552 conf/dac/2008 db/conf/dac/dac2008.html#GaoKKLAM08 Ming-che Lai Zhiying Wang 0003 Lei Gao Hongyi Lu Kui Dai A dynamically-allocated virtual channel architecture with congestion awareness for on-chip routers. 630-633 2008 DAC https://doi.org/10.1145/1391469.1391630 conf/dac/2008 db/conf/dac/dac2008.html#LaiWGLD08 Lei Gao Guangzhou Zeng Dynamic Testing Algorithm Based on Rough Sets for Multiple Fault Diagnosis. 157-163 2008 FSKD (3) https://doi.org/10.1109/FSKD.2008.176 https://doi.ieeecomputersociety.org/10.1109/FSKD.2008.176 conf/fskd/2008-3 db/conf/fskd/fskd2008-3.html#GaoZ08 Lei Gao Chao Li 0001 Ting Fang Zhang Xiong 0001 Vehicle Detection Based on Color and Edge Information. 142-150 2008 ICIAR https://doi.org/10.1007/978-3-540-69812-8_14 conf/iciar/2008 db/conf/iciar/iciar2008.html#GaoLFX08 Lei Gao Guangzhou Zeng S^2AN-WBN: An Innovative Hybrid P2P Location Network. 529-535 2008 ISCSCT (1) https://doi.org/10.1109/ISCSCT.2008.232 https://doi.ieeecomputersociety.org/10.1109/ISCSCT.2008.232 conf/iscsct/2008 db/conf/iscsct/iscsct2008-1.html#GaoZ08 Lei Gao Chao Li 0001 Yi Guo Zhang Xiong 0001 Automatic Learning of Semantic Region Models for Event Recognition. 40-44 2008 ISDA (2) https://doi.org/10.1109/ISDA.2008.14 https://doi.ieeecomputersociety.org/10.1109/ISDA.2008.14 conf/isda/2008 db/conf/isda/isda2008-2.html#GaoLGX08 Chengjun Zhu Chao Li 0001 Lei Gao Zhang Xiong 0001 Skew Estimation and Segmentation of Text Line in Video Frames. 379-383 2008 ISIP https://doi.org/10.1109/ISIP.2008.22 https://doi.ieeecomputersociety.org/10.1109/ISIP.2008.22 conf/isip/2008 db/conf/isip/isip2008.html#ZhuLGZ08 Torsten Kempf Kingshuk Karuri Lei Gao Software Instrumentation. 2008 Wiley Encyclopedia of Computer Science and Engineering https://doi.org/10.1002/9780470050118.ecse386 reference/wiley/2008 db/reference/wiley/wiley2008.html#KempfKG08 Lei Gao Stefan Kraemer Rainer Leupers Gerd Ascheid Heinrich Meyr A fast and generic hybrid simulation approach using C virtual machine. 3-12 2007 conf/cases/2007 CASES https://doi.org/10.1145/1289881.1289885 db/conf/cases/cases2007.html#GaoKLAM07 Stefan Kraemer Lei Gao Jan Weinstock Rainer Leupers Gerd Ascheid Heinrich Meyr HySim: a fast simulation framework for embedded software development. 75-80 2007 CODES+ISSS https://doi.org/10.1145/1289816.1289837 conf/codes/2007 db/conf/codes/codes2007.html#KraemerGWLAM07 Lei Gao Chao Li 0001 Chengjun Zhu Zhang Xiong 0001 A Motion Compensated De-interlacing Algorithm for Motive Object Capture. 74-81 2007 conf/hci/2007-12 HCI (12) https://doi.org/10.1007/978-3-540-73321-8_9 db/conf/hci/hci2007-12.html#GaoLZX07

Weizhe Zhang Binxing Fang Mingzeng Hu Xinran Liu Hongli Zhang 0001 Lei Gao Multisite co-allocation scheduling algorithms for parallel jobs in computing grid environments. 906-926 2006 49 Sci. China Ser. F Inf. Sci. 6 https://doi.org/10.1007/s11432-006-2034-2 db/journals/chinaf/chinaf49.html#ZhangFHLZG06

Nalini Moti Belaramani Michael Dahlin Lei Gao Amol Nayate Arun Venkataramani Praveen Yalagandula Jiandan Zheng PRACTI Replication. 2006 conf/nsdi/2006 NSDI http://www.usenix.org/events/nsdi06/tech/belaramani.html db/conf/nsdi/nsdi2006.html#BelaramaniDGNVYZ06 Chengjun Zhu Yuanxin Ouyang Lei Gao Zhenyong Chen Zhang Xiong 0001 An Automatic Video Text Detection, Localization and Extraction Approach. 1-9 2006 SITIS https://doi.org/10.1007/978-3-642-01350-8_1 conf/sitis/2006 db/conf/sitis/sitis2006.html#ZhuOGCX06

Heng Li Jin-Song Liu Zhao Xu Jiao Jin Lin Fang Lei Gao Yu-Dong Li Zi-Xing Xing Shao-Gen Gao Tao Liu Hai-Hong Li Yan Li Li-Jun Fang Hui-Min Xie Wei-Mou Zheng Bailin Hao Test Data Sets and Evaluation of Gene Prediction Programs on the Rice Genome. 446-453 2005 20 J. Comput. Sci. Technol. 4 https://doi.org/10.1007/s11390-005-0446-x https://www.wikidata.org/entity/Q56879013 db/journals/jcst/jcst20.html#LiLXJFGLXGLLLFXZH05

Lei Gao Michael Dahlin Amol Nayate Jiandan Zheng Arun Iyengar Improving Availability and Performance with Application-Specific Data Replication. 106-120 2005 17 IEEE Trans. Knowl. Data Eng. 1 https://doi.org/10.1109/TKDE.2005.10 http://doi.ieeecomputersociety.org/10.1109/TKDE.2005.10 db/journals/tkde/tkde17.html#GaoDNZI05

Mingfeng Tan Zexin Lu Lei Gao Packet Classification Algorithm Using Multiple Subspace Intersecting. 1083-1093 2005 conf/iccnmc/2005 ICCNMC https://doi.org/10.1007/11534310_113 db/conf/iccnmc/iccnmc2005.html#TanLG05 Lei Gao Michael Dahlin Jiandan Zheng Lorenzo Alvisi Arun Iyengar Dual-Quorum Replication for Edge Services. 184-204 2005 conf/middleware/2005 Middleware https://doi.org/10.1007/11587552_10 db/conf/middleware/middleware2005.html#GaoDZAI05

Michael Dahlin Bharat Chandra Lei Gao Amol Nayate End-to-end WAN service availability. 300-313 2003 11 IEEE/ACM Trans. Netw. 2 https://doi.org/10.1109/TNET.2003.810312 db/journals/ton/ton11.html#DahlinCGN03

Lei Gao Michael Dahlin Amol Nayate Jiandan Zheng Arun Iyengar Application specific data replication for edge services. 449-460 2003 conf/www/2003 WWW https://doi.org/10.1145/775152.775217 db/conf/www/www2003.html#GaoDNZI03 Lei Gao Lina J. Karam Martin Reisslein Glen P. Abousleman Error-resilient image coding and transmission over wireless channels. 629-632 2002 conf/iscas/2002 ISCAS (5) https://doi.org/10.1109/ISCAS.2002.1010782 db/conf/iscas/iscas2002-5.html#GaoKRA02 Bharat Chandra Michael Dahlin Lei Gao Amol Nayate End-to-End WAN Service Availability. 97-108 2001 conf/usits/2001 USITS http://www.usenix.org/events/usits01/chandra.html db/conf/usits/usits2001.html#ChandraDGN01 Bharat Chandra Michael Dahlin Lei Gao Amjad-Ali Khoja Amol Nayate Asim Razzaq Anil Sewani Resource management for scalable disconnected access to Web services. 245-256 2001 conf/www/2001 WWW https://doi.org/10.1145/371920.372059 db/conf/www/www2001.html#ChandraDGKNRS01 Lei Gao Yasuhiro Mukaigawa Yuichi Ohta Synthesis of Facial Images with Lip Motion from Several Real Views. 181-186 1998 conf/fgr/1998 FG db/conf/fgr/fg1998.html#GaoMO98 Glen P. Abousleman Salim Ahmed Muhammad Hamad Alizai Lorenzo Alvisi Murali Annavaram Murali Annavarm Nimar S. Arora Gerd Ascheid Aditya Auradkar Amir Salman AvestimehrSalman Avestimehr Hongming Bai Huidong Bai Linyue Bai Xiaoping Bai Prithviraj BanerjeePrith Banerjee Chenfu Bao HengDa Bao Nalini Moti Belaramani Mark Billinghurst Chavdar Botev Alan BourkeAlan K. Bourke Alisa G. Brink Qiangsheng Bu Baoping Cai Chenzhi Cai Guojun Cai Jianfeng Cai 0002 Peng Cai Shuling Cai Shuo Cai Zhiyuan Cai Thomas Calderon 0001Thomas G. Calderon Baolu Cao Danyang Cao Shuangqian Cao Yulong Cao Jianjiang Ceng Ching Sing Chai Jing Chai Kit Yan Chan Bharat Chandra Zhenghu Chang Bodong Chen Dahua Chen Jianyou Chen Jiming Chen 0001 Jingying Chen 0001 Lei Chen Liang Chen Ling-Jiao Chen Mingxiang Chen Nan Chen Peng Chen 0028 Qichang Chen Shuxuan Chen Siqi Chen Wei Chen 0001 Wenchao Chen Xiao Long Chen Xiao-Cun Chen Xiaorui Chen Xiuheng Chen Xuepeng Chen Yangzhe Chen Yaoran Chen Yilin Chen Ying Chen 0007 Yiping Chen Yundai Chen Yunlong Chen Yunsheng Chen Zhenyong Chen Zhixin Chen Hao Cheng Hongjie Cheng Peng Cheng 0001 Xueting Cheng Yongqiang Cheng 0002 Prafulla Kumar Choubey Xiaojie Chu Tat-Seng Chua Jialei Cui Jingyu Cui Xiaotong Cui Zhiming Cui 0002 Michael Dahlin Kui Dai Shiyun Dai Shirshanka Das Bin Deng 0002 Li-ping Deng Min Deng Xingxing Diao Guodong Ding Yao Ding 0010 Yijie Ding Yongke Ding Feibiao Dong Yong Dou Dajun Du Jianwei Du Sichun Du Jianli Duan Lina Duan Yandong Duan Sibel Eker Jihad El-Sana Peter Ellison Chao Fan Yukang Fan Yunchao Fan Yunfei Fan Binxing Fang Li-Jun Fang Lin Fang Ting Fang Alex Feinberg Hui Feng Kaiyuan Feng Siqi Feng Allan Fowler Qiming Fu 0001 Xinsha Fu Zheng Fu Zhuo-Lin Fu Daniel de la Fuente-Sáiz Han Fujun Phanindra Ganti Chuntan Gao Cong Gao Hui Gao Jinghuai Gao Ning Gao Qinhe Gao Shao-Gen Gao Wang Gao Xue Gao Yichang Gao Zhongtian Gao Shen Ge Yong Ge Vaibhav Gera Bhaskar Ghosh Matthew S. GibbsMatthew Gibbs Peter R. Gillett Zhenghu Gong Kishore Gopalakrishna R. GovindarajanRamaswamy Govindarajan Haitao Gu Xian-Ming Gu Xin-Ping GuanXinping Guan Chen Guo Fei Guo Jin-Li Guo Jing Guo Junkang Guo Kairui Guo QuanJiang Guo Yi Guo Sandeep Gupta 0001 Di Han 0001 Jingchang Han Jingshan Han Min Han Xian-Feng Han Bailin Hao JiuYue Hao Brendan Harris Chaoyang He 0001 Hao He Huan He Xiaolong He Xingzhou He Yong He 0011 Yuanhong He Thuvan Hoang Simon Hoermann Richang Hong Rui Hou Yan-Zhao HouYanzhao Hou Kai Hu 0001 Mingzeng Hu Moufa Hu Qi Hu Tingting Hu Yupeng Hu Lin Hua Wei Hua 0002 Jia Huang Junjiu Huang Ligang Huang Liu Huang Ruihong Huang Shihong Huang Tong Huang Wei Huang Xu Huang Ying-Ying Huang Yixing Huang Yong Huang Zichen Huang Hui Hui Jiahao Huo Arun Iyengar Baoquan Ji Guowei Ji Xiaonan Ji Sixiang Jia Weijia Jia 0001 Xiudan Jia Chaoyi Jiang Dalong Jiang Hui Jiang Jingfei Jiang Mengyun Jiang Min Jiang 0009 Wei Jiang 0038 Xianfu Jiang Xue-Jiao Jiang Ye Jiang Yi Jiang Yinghui Jiang Zheng Jiang 0005 Jesse S. Jin Jiao Jin Yifei Jing Zhongliang Jing Klaus Joehnk Morris Siu-Yung Jong Bing Kang Gezheng Kang Lina J. Karam Kingshuk Karuri Hongchang Ke Torsten Kempf Javed Akbar Khan Amjad-Ali Khoja Sungwoo Kim 0003 Gangqiang Kong Wenxin Kong Xiangdi Kong Joel Koshy Stefan Kraemer Kevin Krawez Jay Kreps Bhaskar Krishnamachari Alexis Kuppersmith Mingche LaiMing-che Lai Xiaolong Lai Yuan-Dong Lan Olaf Landsiedel Alan Pak Tao Lau Gun A. Lee Sunwoo Lee 0001 Hao Lei Ting Lei Rainer Leupers Boxuan Li Chao Li Chao Li 0001 Chaoqian Li Chunxin Li Dazhuang Li Dongguo Li Erbing Li Fenglei Li Guangda Li Guangwang Li Hai-Hong Li Haifeng Li 0007 Haiou Li Hao Li Haoran Li Heng Li Huiling Li Jiang Li 0003 Jiaxin Li JinHong Li Jiting Li Keqiang Li 0001 Keru Li Lusi Li Mengxuan Li 0004 Mingkun Li Minzhe Li Muzhou Li Na Li 0001 Nanxi Li Pengfei Li Ping Li Qingping Li Qingyang Li 0004 Quanyun Li Ruiheng Li Sheng Li Wenwen Li Wujiao Li Xia Li 0004 Xiang Li Xiang Li 0014 Xiaole Li Xiaowei Li Xing Li 0007 Yafei Li Yan Li Yang Li Yanpeng Li Yanzhe Li Yaotang Li Yong Li Yongfu Li 0001 Yuanxiang Li Yudong LiYu-Dong Li Yuheng Li Yujia Li Zhengfeng Li Zhi Li Zhi Li 0066 Zhixu Li Huawei Liang Yuqing Liang Jianxin Liao Jinyong Lin Xin Lin Yang Lin Yunkun Lin Robert W. LindemanRob Lindeman 0001 Huajing Ling Ai Liu An Liu 0002 Aolei Liu Bao Liu Chao Liu Chaorun Liu Feng Liu 0005 Fengming Liu Fu Liu 0001 Guijie Liu Haonan Liu Hongran Liu Hongwei Liu Huixian Liu Huiying Liu Jian Liu Jiang Liu 0016 Jin-Song Liu Jing Liu Jun-Chi Liu Keyang Liu Li Liu 0041 Lin Liu Min Liu Mingbo Liu Qi Liu 0045 Ruyu Liu Shuang Liu 0002 Tao Liu Tongcun Liu Wei Liu Xiangdong Liu Xiaodi Liu Xiaohang Liu Xingquan Liu Xinran Liu Xiujin Liu Xuejiao Liu Xuelin Liu Yaliang Liu Yang Liu 0008 Yaping Liu Yi Liu 0128 Yiliu Liu Yin Liu Ying Liu Yongbin Liu Yonghong Liu Yu Liu 0003 Zhenbo Liu Zhicheng Liu Zhihao Liu Zhixiang Liu Zhixin Liu Zhixin Liu 0001 Zhuolin Liu Ziyao Liu Jinpeng Long Miaolang Long Yu Long 0004 Chao Lu 0001 Guanghua Lu Heping Lu Hongyi Lu Jianyuan Lu Jingfeng Lu Junpeng Lu Shi Lu Weizhong Lu Xiufeng Lu Zexin Lu Changliang Luo Fei Luo Ganzhong Luo Pengpeng Lv Xinhua Lv Biao Lyu Zhi-Lei Lyu Chenyang Ma Dong Ma Hong Ma Honghong Ma Hongsu Ma Huimin Ma Kuikui Ma Lijun Ma Mark Ma Qingna Ma Sheng Ma Tianhao Ma Weirui Ma Xiaohui Ma Xin Ma 0029 Yanchao Ma Ziyang Ma Dave De Maagd Ali H. Mahfouz Andreas K. Maier Cheuk Ming Mak Fuqi Mao Jianghua Mao Lingpeng Meng Heinrich Meyr Fan Min 0001 Hang Ming Gaurav Mittal Enayat A. Moallemi Theodore J. Mock Asmita Mohanty Yasuhiro Mukaigawa Sunil Nagaraj Fang Nan Neha Narkhede Amol Nayate Vennela Chowdary Nekkanti John Nelson Ming Ni Zhenhua Ni Yonghui Nie Qun Niu Runxin Niu Yue Niu Yuichi Ohta Samuel Ortega-Farías Zhengkang Ou Yuanxin Ouyang Alexander Pachev Sasha Pachev Han Pan Hongguang Pan Liming Pan Tian Pan 0001 Yong Pan Yue Pan Zhuohong Pan Zhengbin Pang Long Peng Qiuping Peng Wei Peng 0005 Xinhua Peng Yan Peng Igor Perisic Aditya Rajendra Pharande Thammathip Piumsomboon Alexander Preuhs Shiku Pu Guozhen Qi Xiaokang Qi Shuai Qian Xifu Qian Lin Qiao Donghong Qin Haoxiang Qin Fengqi Qiu Lizhong Qiu Yuwei Qiu Hui Qu Tom Quiggle Prakash Raghavendra Arun Ramachandran Xiangdong Ran Jun Rao Asim Razzaq Martin Reisslein Wenyao Ren Xuanguang Ren Won Woo Ro Na Ruan Felix Russell Felicjan Rydzak Prasanth Sasikumar Dan Schonfeld Bob Schulman Abraham Sebastian Oliver Seeliger Anil Sewani Sam Shah Zhiguang Shan Fei Shao Xiaoyan Shao Zhiming Shao Xiaoming She Minghui Shen Qidong Shen Jiexin Sheng Victor S. Sheng Kunal Sheth Wei Shi Zhe Shi Zhenyun Shi Boris Shkolnik Adam Silberstein Jasleen Singh Chinmay Soman Naveen Somasundaram Bo Song Enge Song Xianming Song Yuanwen Song Yun Song Rajendra P. Srivastava Jiawei Su Manman Su Subbu Subramaniam Tengfei Sui Zhongfei Sui Roshan Sumbaly Changjiu Sun Haobo Sun Hongbin Sun Qirun Sun Ruiyan Sun Xiaohan Sun Xiaoqing Sun Yanbiao Sun YangYang Sun Yingping Sun Yingxue Sun Jintao Suo Kapil Surlaker Deepthi Swamy Bo Tan Mingfeng Tan Fengchun Tang Ming Tang 0004 Tingting Tang Xiaofeng Tao 0001 Guifa Teng Meghana Thommondru Fei Tian Jie Tian 0001 Taichang Tian Yong Tian 0001 Toshinobu Tokumoto Xuefang Tong Sajid Topiwala Cuong Tran 0003 Jiajing Tu Ravi Vaidyanathan Balaji Varadarajan Arun Venkataramani Haifeng Wan Jun Wan 0007 Lili Wan Bo Wang Chao Wang 0118 Chen Wang Chengyushu Wang Chenxiao Wang Chenyushu Wang Dong Wang Enci Wang Fengran Wang Guangchen Wang Heng Wang Hongqiang Wang 0001 Hua Wang Hui Wang 0011Jessie Hui Wang Hui Wang 0040 Jiantao Wang Jianxiu Wang Jingyu Wang 0001 Jiuru Wang Ju Wang Jun Wang 0113 Kefei Wang Liandong Wang Liang Wang 0048 Meiqin Wang Meng Wang Min Wang 0031 Ming-Jie Wang Mingjie Wang 0002 Pu Wang 0005 Qianghu Wang Quan Wang Rongyan Wang Rui-Wu Wang Ruibao Wang Shengjie Wang Shuai Wang 0013 Sufen Wang Suikang Wang Tianmiao Wang Wei Wang 0035 Wei Wang 0070 Weijia Wang Weisheng Wang Xianghan Wang Xiaokai Wang Xing Wang Xinxin Wang Xueqing Wang Yaji Wang Yan Wang Yanfeng Wang Yaqiang Wang Yiguang Wang Yihong Wang Yixian Wang Yuan Wang Yuhang Wang Yulong Wang 0001 Yuqi Wang Yuxin Wang Zenghai Wang Zhecheng Wang Zhen Wang 0004 Zhewei Wang Zhiying Wang Zhiying Wang 0003 Zhunhang Wang Zhuo Wang Bing Wei Gaobo Wei Junli Wei Longxiang Wei Lu Wei Xin Wei Zechen Wei Jan Weinstock Dong Wen 0004 Luosheng Wen Zhao Wen Jemiah Westerman Zach White Daniel Wong 0001 Lik Wong Chaolong Wu Cong Wu Hongjie Wu Jian Wu 0002 Jianping Wu Jingwei Wu Kaizheng Wu Pengbo Wu Qiang Wu Qingshun Wu Xialan Wu Xian Wu 0001 Yan-Xue Wu Yuanjie Wu Yuyi Wu Han Xiao Hua Xiao 0002 Liping Xiao Nong Xiao 0001 Tao Xiao Xue Xiao Hui-Min Xie Zhanyuan Xie Gu Quan Xin Yu Xin Chengwen Xing PengJu Xing Zi-Xing Xing Zhang Xiong 0001 Hongli Xu Jia-Long Xu Jinwei Xu Min Xu Mingliang Xu 0001 Ruyi Xu Shiyao Xu Shiyun Xu Xiaodong Xu 0001 Zhao Xu Zhen Xu 0001 Zhongquan Xu Qingshui Xue Praveen Yalagandula Chaogan Yan Jingzhen Yan Jinxing Yan Shu Yan Xiaohong Yan Chao Yang 0038 Hongyong Yang Jiahai Yang 0001 Jian Yang Jie Yang Jun Yang Kai Yang Lin Yang Mandy Yang Shan Yang Weicai Yang Xiao Yang Xingyuan Yang Yanfu Yang Yi Yang Zhenhua Yang Zhi Yang Jianyong Yao Fook Fah Yap Bojia Ye Guizhong Ye Quanliang Ye Zhigang Ye Lizhi Yi Shanwen Yi Qinglong You Changyuan Yu Fei Yu 0009 LuLu Yu Nian Yu Wenxian Yu Xiangjuan Yu Xiaohui Yu 0001 Xinyu Yu Yuanjie Yu Yulong Yu Mingjian Yuan Peijiang Yuan Qiang Yuan Xiaodong Yuan Yazhou Yuan Yubo Yuan 0003 Yue Yuan Zenghui Yuan Zhaodi Yuan Shuai Yue Yin Yue Feng Yun Lou Yunfei Hossein Entezari Zarch David Zaretsky Guangzhou Zeng Li Zeng Yanjie Zeng Yanli Zeng Yonghu Zeng Xiaobing Zha Aiping Zhai Ben Zhang Bin Zhang 0016 Dan Zhang David Zhang 0001 Dingding Zhang Feng Zhang Haifeng Zhang 0003Hai-Feng Zhang 0003 Haiwei Zhang Haoyu Zhang Heng-Ru Zhang Hongli Zhang 0001 Hui Zhang 0052 Jason Zhang Jian Zhang Jie Zhang Kun Zhang 0031 Lei Zhang 0094 Li Zhang 0073 Lidi Zhang Liwei Zhang Mi Zhang 0002 Pengyu Zhang Qinghua Zhang Shaojun Zhang Shize Zhang Shuo Zhang 0012 Tuo Zhang Wei Zhang Wei Zhang 0234 Weizhe Zhang Wenyuan Zhang Xin Zhang Xinnan Zhang Xinxin Zhang Xinye Zhang Xu Zhang 0009 Xueying Zhang Yan Zhang Yanping Zhang 0004 Yanshan Zhang Ying-Yi Zhang Yingqian Zhang 0003 Yingying Zhang Yong Zhang Yu-xin ZhangYuxin Zhang Zhen Zhang 0039 Zhenglin Zhang Zhenlei Zhang Zhiyong Zhang Zhuolong Zhang Zihao Zhang Zimei Zhang Bo Zhao 0012 Honghua Zhao Hongyi Zhao Li Zhao Ling Zhao 0005 Liqian Zhao Peng Zhao Pengchong Zhao Pengpeng Zhao 0001 Weijie Zhao 0013 Wenjing Zhao Xiaoli Zhao 0002 Xiaoyu Zhao Xuan Zhao Yan Zhao Yingbao Zhao Yixin Zhao Chao Zheng Jiandan Zheng Kaihong Zheng Lanqin Zheng Min Zheng Wei-Mou Zheng Yantao Zheng Yefeng Zheng 0001 Zhian Zheng Dantian Zhong Kangping Zhong Lei Zhong Yong Zhong Daqiu Zhou Hengyu Zhou Huai-Min Zhou Kunpeng Zhou Qi Zhou Weihua Zhou Xian Zhou 0001 Yazhou Zhou Yuetian Zhou Yujun Zhou 0011 Chengjun Zhu Haojin Zhu Hu Zhu Jianchi Zhu Jiawei Zhu Menggui Zhu Min Zhu Nuoyi Zhu Qing Zhu 0012 Ruolan Zhu Shunmin Zhu Tao Zhu Xiaofan Zhu Xiaona Zhu Xiaoyong Zhu Yu-Xiao Zhu Zirun Zhu Zhaowen Zhuang Amir Ziashahabi Zhigang Zong Qianyuan Zou