Package: doBy 4.7.2

doBy: Groupwise Statistics, LSmeans, Linear Estimates, Utilities

Utility package containing: Main categories: Working with grouped data: 'do' something to data when stratified 'by' some variables. General linear estimates. Data handling utilities. Functional programming, in particular restrict functions to a smaller domain. Miscellaneous functions for data handling. Model stability in connection with model selection. Miscellaneous other tools.

Authors:Ulrich Halekoh [aut, cph], Søren Højsgaard [aut, cre, cph]

doBy_4.7.2.tar.gz
doBy_4.7.2.zip(r-4.6)doBy_4.7.2.zip(r-4.5)doBy_4.7.2.zip(r-4.4)
doBy_4.7.2.tgz(r-4.6-any)doBy_4.7.2.tgz(r-4.5-any)
doBy_4.7.2.tar.gz(r-4.6-any)doBy_4.7.2.tar.gz(r-4.5-any)
doBy_4.7.2.tgz(r-4.5-emscripten)
doBy.pdf |doBy.html
doBy/json (API)
NEWS

# Install 'doBy' in R:
install.packages('doBy', repos = c('https://hojsgaard.r-universe.dev', 'https://cloud.r-project.org'))

Bug tracker:https://github.com/hojsgaard/doby/issues

Datasets:
  • NIRmilk - Near infra red light (NIR) measurements in milk
  • beets - Beets data
  • breastcancer - Gene expression signatures for p53 mutation status in 250 breast cancer samples
  • budworm - Budworm data
  • cad1 - Coronary artery disease data
  • cad2 - Coronary artery disease data
  • carcass - Lean meat contents of 344 pig carcasses
  • carcassall - Lean meat contents of 344 pig carcasses
  • child_growth - Berkeley Growth Study data
  • codstom - Diet of Atlantic cod in the Gulf of St. Lawrence
  • crickets - Crickets data
  • crimeRate - CrimeRate
  • crime_rate - CrimeRate
  • cropyield - Yield from Danish agricultural production of grain and root crop.
  • dietox - Growth curves of pigs in a 3x3 factorial experiment
  • fatacid - Fish oil in pig food
  • fev - Forced expiratory volume in children
  • haldCement - Heat development in cement under hardening.
  • income - Income data, years of educations and ethnicity
  • math - Mathematics marks for students
  • math_teachers - Height of math teachers
  • mathmark - Mathematics marks for students
  • milkman - Milk yield data for manually milked cows.
  • milkman_rdm1 - Milk yield data for manually milked cows.
  • nir_milk - Near infra red light (NIR) measurements in milk
  • personality - Personality traits
  • potatoes - Weight and size of 20 potatoes
  • prostate - Prostate Tumor Gene Expression Dataset
  • shoes - Wear of shoes
  • shoes_long - Wear of shoes
  • wine - Chemical composition of wine

On CRAN:

Conda:

13.59 score 1 stars 1.0k packages 3.9k scripts 319k downloads 64 mentions 115 exports 50 dependencies

Last updated from:09622808cf. Checks:7 WARNING, 1 ERROR, 1 OK. Indexed: yes.

TargetResultTimeFilesLog
linux-devel-x86_64WARNING196
source / vignettesERROR242
linux-release-x86_64WARNING192
macos-devel-arm64WARNING133
macos-release-arm64WARNING150
windows-develWARNING142
windows-releaseWARNING153
windows-oldrelWARNING152
wasm-releaseOK147

Exports:addadd_intadd_predadd_residaggregate_linest_listalign_coefsas_lhs_chras_lhs_frmas_rhs_chras_rhs_frmbinomial_to_bernoulli_databquote_fun_listcv_glm_fitlistdescStatdividedoby.xtabsesticonexpr_to_funfirstobsformula_addformula_add_strformula_chr_to_formformula_nthformula_polyformula_to_interaction_matrixgenerate_data_listget_contrastsget_formulasget_funget_linest_listget_sectionget_vartypesget_Xget_xlevelsgetByhead2interaction_plotis_estimablelag_datalapply_bylapplyBylastobsLE_matrixlinestlm_bylmByLSmeansmatrix2set_listmb_summarymodel_stability_glmmultorder_byorderByparseGroupFormulapick1pick2plot_lmpopMeanspowrbind_listreciprocalrecode_varrecodeVarrecover_pca_datarenameColresponseresponse_plotsample_bysampleBysapply_bysapplyByscale_byscale_dfscaleBysection_funsection_fun_envsection_fun_subset_covariate_valset_defaultset_list2matrixset_xlevelssimplify_rhssplit_bysplit_by.legacysplit_bycolsplit_byrowsplitBysplitBy.legacysub_seqsubSeqsubset_bysubsetBysubtractsummary_bysummary_mbsummaryBytail2taylorterms_labelstime_since_eventtimeSinceEventto_strtransform_bytransform_forecasttransformBytruncate0unique_formulavvcheckvmapvparsevrenamevselectwhich.maxnwhich.minn

Dependencies:backportsbootbroomclicolorspacecowplotcpp11Derivdplyrfarverforecastfracdiffgenericsggplot2gluegtableisobandlabelinglatticelifecyclelmtestmagrittrMASSMatrixmicrobenchmarkmodelrnlmennetpillarpkgconfigpurrrR6RColorBrewerRcppRcppArmadillorlangS7scalesstringistringrtibbletidyrtidyselecttimeDateurcautf8vctrsviridisLitewithrzoo

Readme and manuals

Help Manual

Help pageTopics
Convert right hand sided formula to a list.rhsf2list
Add interaction columns to data frameadd_int
Add predicted values of different types to dataframeadd_pred
Add residuals of different types to dataframeadd_resid
Align and combine fixed-effect coefficients from multiple modelsalign_coefs
beets databeets
Convert binomial data to bernoulli databinomial_to_bernoulli_data
Backquote a list of functionsbquote_fun_list
Formula based version of lapply and sapplyby-lapply lapplyBy lapply_by sapplyBy sapply_by
List of lm objects with a common modelby-lmby coef.lmBy coef.summary_lmBy fitted.lmBy getBy lmBy lm_by residuals.lmBy summary.lmBy
Ordering (sorting) rows of a data frameby-order orderBy order_by
Sampling from a data frameby-sample sampleBy sample_by
Split a data frame into groups defined by variable(s)by-split head.splitByData splitBy splitBy.legacy split_by split_by.legacy tail.splitByData
Finds subsets of a dataframe which is split by variables in a formula.by-subset subsetBy subset_by
Groupwise summary statisticsby-summary summaryBy summary_by
Function to make groupwise transformationsby-transform transformBy transform_by
Lean meat contents of 344 pig carcassescarcass carcassall
Berkeley Growth Study datachild_growth
Diet of Atlantic cod in the Gulf of St. Lawrence (Canada)codstom
crickets datacrickets
crimeRatecrime_rate
crimeRatecrimeRate
Yield from Danish agricultural production of grain and root crop.cropyield
Cross-validation for list of glm objectscv_glm_fitlist
Gene expression signatures for p53 mutation status in 250 breast cancer samplesbreastcancer data_breastcancer
Budworm databudworm data_budworm
Coronary artery disease datacad1 cad2 data_cad
Mathematics marks for studentsdata_mathmark math mathmark
Personality traitsdata_personality personality
Chemical composition of winedata-wine wine
Computing simple descriptive statistics of a numeric vector.descStat
Growth curves of pigs in a 3x3 factorial experimentdietox
Contrasts for lm, glm, lme, and geeglm objectscoef.esticon_class confint.esticon_class esticon summary.esticon_class vcov.esticon_class
Convert expression into function object.expr_to_fun
Fish oil in pig foodfatacid
Forced expiratory volume in childrenfev
Locate the index of the first/last unique valuefirstlastobs firstobs firstobs.default firstobs.formula lastobs lastobs.default lastobs.formula
Formula operations and coercion.as_lhs_chr as_lhs_frm as_rhs_chr as_rhs_frm formula_add formula_add_str formula_chr_to_form formula_nth formula_ops formula_poly formula_to_interaction_matrix simplify_rhs simplify_rhs.character simplify_rhs.formula terms_labels to_str unique_formula
Generate data listgenerate_data_list
Get formulas from model_stability_glm_class objectget_formulas
Heat development in cement under hardening.haldCement
head and tail for matriceshead2 head_matrix tail2
Income data, years of educations and ethnicityincome
Two-way interaction plotinteraction-plot interaction_plot
Determines if contrasts are estimable.is_estimable
Construct lagged regressors and aligned responselag_data
Compute linear estimatescoef.linest_class confint.linest_class linest linest.default linest.geeglm linest.glm linest.lm linest.lmerMod linest.merMod summary.linest_class
Auxillary functions for computing lsmeans, contrasts etcget_contrasts get_contrasts.default get_contrasts.merMod get_vartypes get_X get_X.default get_X.merMod get_xlevels get_xlevels.default get_xlevels.mer get_xlevels.merMod linest-get set_covariate_val set_xlevels
Linear estimates matrixaggregate_linest_list get_linest_list LE_matrix LE_matrix.default linest-matrix
Compute LS-means (aka population means or marginal means)ls-means LSmeans LSmeans.default LSmeans.lmerMod popMeans popMeans.default popMeans.lmerMod
Height of math teachersmath_teachers
Fast summary of microbenchmark objectmb_summary summary_mb
Milk yield data for manually milked cows.milkman milkman_rdm1
Model stability for glm objectsmodel_stability_glm
Near infra red light (NIR) measurements in milkNIRmilk nir_milk
Extract components from a formula with "conditioning bar"parseGroupFormula
Extract (pick) elements without using bracketspick1 pick2 pick_elements
Pipe-friendly arithmetic helpersadd divide mult pipe_arithmetic pow reciprocal subtract
Plot linear model objectplot_lm
Weight and size of 20 potatoespotatoes
Prostate Tumor Gene Expression Datasetprostate
Bind list of data frames and add list names as a columnrbind_list
Recode values of a vectorrecodeVar recode_var
Recover data from principal component analysisrecover_pca_data
Rename columns in a matrix or a dataframe.renameCol
Get response variable from modelresponse
Plot the response variable against the predictor variables.response_plot
Scale numeric variables in a data framescale_df
Group-wise scaling of datascaleBy scale_by
Section a function and set default values in functionget_fun get_section section_fun section_fun_env section_fun_sub
Set default values in a functions argumentsset_default
Matrix representatation of list of vectors and vice versamatrix2set_list set_list2matrix set_list_set_matrix
Wear of shoesshoes shoes_long
Split matrix or dataframe into listsplit_bycol split_byrow split_byrow_bycol
Find sub-sequences of identical elements in a vector.subSeq sub_seq
Taylor expansion (one dimension)taylor
Tidy an esticon objecttidy-esticon tidy.esticon_class
Tidy a linest objecttidy-linest tidy.linest_class
Calculate "time since event" in a vectortimeSinceEvent time_since_event
Transform forecasts from model scale to data scale by simulationtransform_forecast
Truncate values in a matrix / vector to zero if they are below a certain threshold.truncate0
Shorthand for vparse()v
Check if variables exist in a data framevcheck
Apply a function to each parsed variable namevmap
Variable utilities: parse, select, check, map, renamevparse
Rename columns in a data framevrename
Select columns from a data frame using flexible inputvselect
Where are the n largest or n smallest elements in a numeric vector ?which.maxn which.minn